Shewanella baltica OS117: Sbal117_0444 Help Entry Sbal117_0444      CDS       T02013                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sbs  Shewanella baltica OS117 Pathway sbs01100   Metabolic pathways sbs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sbal117_0444    00074 Mycolic acid biosynthesis     Sbal117_0444   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sbal117_0444 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AEH12241 LinkDB All DBs Position complement(488155..488403) Genome browser AA seq 82 aa AA seqDB search MQNREQILAMLTTILVDEFEIEAEAITPEANLYEELDLDSIDAVDLVIKLQQLTGKKIQP DEFKSVRTVNDVVNAIEGLVKD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaatcgtgaacaaatcctcgctatgctgaccactattttagtggatgaattcgaa attgaggccgaggcgattacgcctgaggccaacctgtatgaagagctcgatctcgacagt attgatgccgtcgacttagtgattaagctgcagcaactgacgggtaaaaagatccaaccc gatgaatttaaatcagttcgcacagtcaacgatgtggttaatgccatcgaaggtttagtt aaagactaa

DBGET integrated database retrieval system