Shewanella baltica OS117: Sbal117_0445 Help Entry Sbal117_0445      CDS       T02013                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism sbs  Shewanella baltica OS117 Pathway sbs01100   Metabolic pathways sbs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sbal117_0445    00074 Mycolic acid biosynthesis     Sbal117_0445   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sbal117_0445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEH12242 LinkDB All DBs Position complement(488413..488667) Genome browser AA seq 84 aa AA seqDB search MNLNNEIKQLIIDCLDLEDVSIDDIETDAPLFGEGLGLDSIDALELGLAIKKKFDVKIEA NSDATKAHFHSVASLASFIESQRP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaacttaaacaatgaaataaagcagttaatcatcgactgtctcgatcttgaagacgtc agtattgatgatattgaaaccgatgcgccgctctttggcgaaggtctaggcttagattca atcgacgccctcgaactcggcttagccatcaagaaaaaatttgatgtcaaaatcgaagct aattcggatgccactaaggcccatttccacagtgttgccagcttagctagctttatcgaa tcacagcgtccatag

DBGET integrated database retrieval system