Streptomyces buecherae: H7H31_09190 Help Entry H7H31_09190       CDS       T07050                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sby  Streptomyces buecherae Pathway sby00190   Oxidative phosphorylation sby01100   Metabolic pathways Module sby_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sby00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     H7H31_09190  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sby00194]     H7H31_09190 Photosynthesis proteins [BR:sby00194]  Photosystem and electron transport system   F-type ATPase [OT]    H7H31_09190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QNJ40028 LinkDB All DBs Position complement(2497404..2497652) Genome browser AA seq 82 aa AA seqDB search MSALQTIAAGVELKGNLGSIGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLIRANQIL GFAFCEALALIGLVMPFVYPTS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtccgctctccagaccattgctgctggtgtcgaactcaagggcaacctcggctcgatc ggttacggcctcgcggccatcggccccggcgtcggcgtcggcatcatcttcggtaacggc acccaggccctcgcccgtcagcccgaggctgccggtctgatccgcgccaaccagatcctc ggcttcgccttctgtgaggcgctcgccctgatcggtctggtcatgccgttcgtctacccg accagctga

DBGET integrated database retrieval system