Streptomyces buecherae: H7H31_18285 Help Entry H7H31_18285       CDS       T07050                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sby  Streptomyces buecherae Pathway sby00998   Biosynthesis of various antibiotics sby01100   Metabolic pathways sby01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sby00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H7H31_18285    00074 Mycolic acid biosynthesis     H7H31_18285   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H7H31_18285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding HV_small_capsid ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QNJ41525 LinkDB All DBs Position 4718471..4718731 Genome browser AA seq 86 aa AA seqDB search MSTATKQEQLDEIREIVAEVLELEPEEISETSHFIEEHEADSLRAIEILARLEKKYKVEI PQSELPKMINLTEVYNVLAEHAGWQG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcgaccgccaccaagcaggagcagctcgacgagatccgcgaaatcgtcgcggaggtg ctggagcttgagcccgaggagatctcggagaccagccacttcatcgaggagcacgaggcc gactcgctgcgcgcgatcgagatcctcgcccgcctggagaagaagtacaaggtggagatc ccgcagtcggagctccccaagatgatcaacctcaccgaggtctacaacgtgctcgccgag cacgctggttggcagggctga

DBGET integrated database retrieval system