Salmonella bongori N268-08: A464_116 Help Entry A464_116          CDS       T02733                                  Name (GenBank) Cell division protein FtsL   KO K03586   cell division protein FtsL Organism sbz  Salmonella bongori N268-08 Brite KEGG Orthology (KO) [BR:sbz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sbz03036]     A464_116 Chromosome and associated proteins [BR:sbz03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     A464_116 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  AGR57302 UniProt:  S5NAG9 LinkDB All DBs Position 121601..121843 Genome browser AA seq 80 aa AA seqDB search MFICIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIA TEKLQMQHVDPSQENIVVQK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt ttgttcatttgcatcattttaacggcggtgacggtggtaacaacggcgcaccatactcgt ctgctcaccgctcagcgtgaacagctggtcctggagcgcgatgcattggacattgaatgg cgcaacctgatccttgaagaaaacgcgctcggcgatcatagccgggtagagcggattgca acggaaaagctgcaaatgcagcatgttgatccatcacaagaaaatatcgtagtgcaaaaa taa

DBGET integrated database retrieval system