Staphylococcus carnosus subsp. carnosus: SCA_2230 Help Entry SCA_2230          CDS       T00863                                  Name (GenBank) hypothetical protein   KO K07458   DNA mismatch endonuclease, patch repair protein [EC:3.1.-.-] Organism sca  Staphylococcus carnosus subsp. carnosus Brite KEGG Orthology (KO) [BR:sca00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sca03400]     SCA_2230 DNA repair and recombination proteins [BR:sca03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      SCA_2230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF559 MTES_1575 Vsr Motif Other DBs NCBI-ProteinID:  CAL29133 UniProt:  B9DJB0 LinkDB All DBs Position 2287748..2288020 Genome browser AA seq 90 aa AA seqDB search MLVFVDGEFWHGYDWENVKKQRIHTNRDYWIPKLERNMERDQEVNQKLKDMGYTVIRFWE KHEVFKDMDGCVNQVLEAIEHNKKQMKKEK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgctcgtatttgtcgatggtgaattttggcatggatacgattgggaaaacgtcaaaaag caacgtatccatacaaatcgagactattggattccaaaactagaacggaatatggaacgt gatcaggaagtgaaccaaaagcttaaagacatgggttatactgtcattcgtttctgggaa aaacatgaagttttcaaagatatggatggttgtgtcaatcaagttttagaagcgattgag cacaataagaagcagatgaaaaaagagaaataa

DBGET integrated database retrieval system