Shewanella carassii: TUM17387_06240 Help Entry TUM17387_06240    CDS       T07543                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism scaa  Shewanella carassii Pathway scaa02024   Quorum sensing scaa03018   RNA degradation Brite KEGG Orthology (KO) [BR:scaa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     TUM17387_06240 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     TUM17387_06240 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:scaa03019]     TUM17387_06240 (hfq)    03036 Chromosome and associated proteins [BR:scaa03036]     TUM17387_06240 (hfq) Messenger RNA biogenesis [BR:scaa03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      TUM17387_06240 (hfq) Chromosome and associated proteins [BR:scaa03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     TUM17387_06240 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  BCV65265 LinkDB All DBs Position 681828..682103 Genome browser AA seq 91 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAIS TVVPSRPFNVSNHQSGGQQNYNSQHDDSSEQ NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagacccatttctgaacgcacttcgccgtgagcgcgtt cctgtttccatctacctggtcaacggtatcaagttgcagggacaggtggagtcttttgac cagttcgtgatcttgctgaaaaacacggttagccagatggtttacaagcacgccatttcg actgtagtgccttctcgtcccttcaatgtgagcaatcatcaaagtggcggtcagcaaaac tacaactcgcagcacgacgatagcagcgaacagtaa

DBGET integrated database retrieval system