Sphingomonas cannabina: LZK98_08860 Help Entry LZK98_08860       CDS       T08607                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scab  Sphingomonas cannabina Pathway scab01100   Metabolic pathways scab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LZK98_08860    00074 Mycolic acid biosynthesis     LZK98_08860   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LZK98_08860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UIJ47035 LinkDB All DBs Position complement(1842498..1842743) Genome browser AA seq 81 aa AA seqDB search MSDRNQIFETVKAQIEPFNKKGVTLTESTTFQGDLEWDSLTVMDFVAAIEDEFDIIITMN MQAEIETVGQLVDAVAKLKDA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccgcaaccagattttcgagaccgtcaaggcgcagatcgaacccttcaacaag aagggcgtcaccttgaccgagagcaccaccttccagggcgacctcgagtgggacagcctg accgtgatggacttcgtcgcggcgatcgaggacgagttcgacatcatcatcacgatgaac atgcaggccgagatcgagacggtcggccagctcgtcgacgccgtcgccaagctcaaggac gcgtga

DBGET integrated database retrieval system