Sphingomonas cannabina: LZK98_10830 Help Entry LZK98_10830       CDS       T08607                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scab  Sphingomonas cannabina Pathway scab01100   Metabolic pathways scab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LZK98_10830    00074 Mycolic acid biosynthesis     LZK98_10830   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LZK98_10830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  UIJ43591 LinkDB All DBs Position 2302278..2302514 Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAIAYIDEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaaccgccgaccgcgtgaagaagatcgtcgtcgagcacctcggcgtcgaggcg gacaaggtgaccgaggacgcgagcttcatcgacgatctgggcgcggacagcctcgacatc gtcgagctggtgatggcgttcgaggaagagttcggggtcgagatcccggacgacgccgcc gagaagatcacgaccgtcaaggacgcgatcgcgtacatcgacgagcacaagggctga

DBGET integrated database retrieval system