Stomoxys calcitrans (stable fly): 106084831 Help Entry 106084831         CDS       T07664                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism scac  Stomoxys calcitrans (stable fly) Pathway scac04013   MAPK signaling pathway - fly scac04145   Phagosome scac04148   Efferocytosis scac04310   Wnt signaling pathway scac04620   Toll-like receptor signaling pathway scac05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:scac00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     106084831    04310 Wnt signaling pathway     106084831  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106084831    04148 Efferocytosis     106084831  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106084831  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     106084831  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:scac04131]     106084831   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:scac04147]     106084831    04031 GTP-binding proteins [BR:scac04031]     106084831 Membrane trafficking [BR:scac04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     106084831  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     106084831   Macropinocytosis    Ras GTPases     106084831  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     106084831 Exosome [BR:scac04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106084831   Exosomal proteins of other body fluids (saliva and urine)    106084831   Exosomal proteins of colorectal cancer cells    106084831   Exosomal proteins of bladder cancer cells    106084831 GTP-binding proteins [BR:scac04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     106084831 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  106084831 NCBI-ProteinID:  XP_013104217 UniProt:  A0A1I8Q976 LinkDB All DBs Position 1:complement(213772211..213773253) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR DDKNTIEKLRDKKLTPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV LQPKSKRKCTLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggctatcaagtgcgttgtggttggggacggagcggtaggtaagacatgtctactc atcagctacacaacgaatgcatttcccggagaatacataccaaccgtattcgataattat tcggccaatgttatggtggatgccaaacccattaatttaggtctttgggatacagctggc caagaggattatgatcgtctgcgtcccttgtcgtatccccaaacagatgtatttctaatt tgcttttctctggttaatccagcctcattcgagaacgtccgtgcaaaatggtatccagaa gtacgccatcactgcccaaatacccctataatattagtgggtaccaaactggatttgcga gatgacaagaacaccattgaaaaattacgtgacaagaaattgacacccattacctatcca cagggactggcaatggccaaagaaataggagccgtaaagtatttggaatgttcggcctta acacaaaaaggactgaagaccgtctttgatgaagccatacgttcagtattgtgtcccgtc ttgcagcccaagtcaaaacgtaaatgtacgttgctataa

DBGET integrated database retrieval system