Stomoxys calcitrans (stable fly): 106086464 Help Entry 106086464         CDS       T07664                                  Name (RefSeq) LIRP-like   KO K04526   insulin Organism scac  Stomoxys calcitrans (stable fly) Pathway scac04068   FoxO signaling pathway scac04081   Hormone signaling scac04140   Autophagy - animal scac04150   mTOR signaling pathway scac04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:scac00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     106086464    04150 mTOR signaling pathway     106086464   09133 Signaling molecules and interaction    04081 Hormone signaling     106086464  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106086464  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     106086464  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:scac04052]     106086464 Cytokines and neuropeptides [BR:scac04052]  Neuropeptides   Unclassified    106086464 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  106086464 NCBI-ProteinID:  XP_013106606 UniProt:  A0A1I8NN69 LinkDB All DBs Position 4:complement(130762242..130772218) Genome browser AA seq 127 aa AA seqDB search MKFSQFKISSRVLNSTASTLLVIGFIVIISLPTPAHTQPVTLHARNVPHQRYCSLSLFEA IKVICNGRYNSLSNNYPESFGNQNRASLLKRLVPDDDVIYRPSFGGPVHECCRRPCGYSE LQQYCAD NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgaagttttcccaattcaaaatctcatcacgtgtgttaaactctacggcgagcacactc ttagtcataggctttattgtgataatatccctaccaacacctgcccacacacaacctgtt acactgcatgcgcgaaatgtaccgcaccagcgttactgtagtttatcgttatttgaggcc atcaaggtgatatgtaacggacgttacaattctctctcaaataattatcccgaaagtttt ggcaatcaaaatcgtgccagtcttttgaaacgtttggtaccggatgacgatgtcatatac cgaccctcatttggtggcccagtacatgaatgctgtcgccgtccctgtggctattcagaa ctgcagcaatattgtgcggattaa

DBGET integrated database retrieval system