Stomoxys calcitrans (stable fly): 106089198 Help Entry 106089198         CDS       T07664                                  Name (RefSeq) protein chibby homolog 1   KO K23402   protein chibby 1 Organism scac  Stomoxys calcitrans (stable fly) Pathway scac04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:scac00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     106089198  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:scac03037]     106089198 Cilium and associated proteins [BR:scac03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    106089198 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Chibby Motif Other DBs NCBI-GeneID:  106089198 NCBI-ProteinID:  XP_013110446 UniProt:  A0A1I8QDY2 LinkDB All DBs Position 2:36299165..36299548 Genome browser AA seq 109 aa AA seqDB search MPLFNKKFESKPIPPRTSRCNNGCPIVNEDLDDYKQISLNLGNKELRFADGIWIHSSRKG DVDEVIRLNRRLKSLEEESNMSDVKIEVLLDLLAEHATMINVLKSNKEK NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgcctttatttaataaaaaatttgaatcgaaacctataccaccgcgcacctcacgatgc aataatggctgtcctatagtgaatgaagatttagatgattacaaacaaatttccttgaat ttgggcaataaggagttacgctttgccgatggcatatggatacattcatcacgtaagggt gatgtggatgaagttattcgattaaatcggcgcctgaaatcactagaggaagagagcaat atgtcggatgtaaaaatagaggtgctattggatctattggccgagcatgctacaatgatc aatgttttgaaatcaaataaagagaaataa

DBGET integrated database retrieval system