Stomoxys calcitrans (stable fly): 106089879 Help Entry 106089879         CDS       T07664                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism scac  Stomoxys calcitrans (stable fly) Brite KEGG Orthology (KO) [BR:scac00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:scac03041]     106089879   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:scac04052]     106089879 Spliceosome [BR:scac03041]  Complex B   Other components    Complex B specific factors     106089879 Cytokines and neuropeptides [BR:scac04052]  Neuropeptides   Unclassified    106089879 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler PI3K_rbd OTU1_UBXL Motif Other DBs NCBI-GeneID:  106089879 NCBI-ProteinID:  XP_013111323 UniProt:  A0A1I8Q2L1 LinkDB All DBs Position 4:complement(116111437..116113277) Genome browser AA seq 73 aa AA seqDB search MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKYDKIVLKKWYTIFKDSIKLSDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaaataacttgtaatgacagattaggcaaaaaagtacgcgtgaaatgtaatcca gacgacaccatcggtgacctaaagaaacttatagcagcgcaaactggtacaaaatacgat aaaattgttttgaaaaagtggtacacaatctttaaggacagcattaaactttcggattat gagatccacgacggcatgaatttggagctgtattatcaataa

DBGET integrated database retrieval system