Stomoxys calcitrans (stable fly): 106095220 Help Entry 106095220         CDS       T07664                                  Name (RefSeq) ras-related protein rac-2-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism scac  Stomoxys calcitrans (stable fly) Pathway scac04013   MAPK signaling pathway - fly scac04145   Phagosome scac04148   Efferocytosis scac04310   Wnt signaling pathway scac04517   IgSF CAM signaling scac04518   Integrin signaling scac04620   Toll-like receptor signaling pathway scac05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:scac00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     106095220    04310 Wnt signaling pathway     106095220   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     106095220    04518 Integrin signaling     106095220  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106095220    04148 Efferocytosis     106095220  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106095220  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     106095220  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:scac04131]     106095220   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:scac04147]     106095220    04031 GTP-binding proteins [BR:scac04031]     106095220 Membrane trafficking [BR:scac04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     106095220  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     106095220   Macropinocytosis    Ras GTPases     106095220  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     106095220 Exosome [BR:scac04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106095220   Exosomal proteins of other body fluids (saliva and urine)    106095220   Exosomal proteins of colorectal cancer cells    106095220   Exosomal proteins of bladder cancer cells    106095220 GTP-binding proteins [BR:scac04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     106095220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc MMR_HSR1 Arf AAA_24 RE_BsaWI AAA_14 Motif Other DBs NCBI-GeneID:  106095220 NCBI-ProteinID:  XP_013117916 UniProt:  A0A1I8Q527 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MRLFKCVILGHTQAGKSSLLRTYINKTFCGNLDATTNELYTIQIQAPNGYMADLQLWDTS GLVTNDYISRLYFPNTDVFLICYSAADGAAIVLVATKTDLRDDVAHLKKWNLKAINYEAG QQLAAEIKALKYLECSALEEVGVSAVFDAVEAACVKNCMSSNSMDYENEEKQGENEKLEG VNKCSIM NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgcgactcttcaaatgtgtgatacttggtcacacacaggctggcaaaagcagtctgcta aggacatacataaacaaaactttctgcggaaatttggatgctaccaccaatgaactgtat acaatacaaatccaagccccaaatggctacatggcagatctacaattatgggatacgtca ggtcttgtaaccaatgattatataagccgtttatattttcccaacacggatgtttttctc atatgctattcagcggccgatggtgcggctatcgtattggttgccaccaaaactgatttg cgtgatgatgtggcacatctcaaaaaatggaatctaaaagccataaactatgaggcaggt caacaattagctgcagaaataaaagctctgaaatatcttgaatgttcagccctggaggaa gttggagtttcggcagtgtttgatgctgtggaggcagcatgtgtcaaaaattgtatgtca tctaatagtatggattatgaaaatgaagaaaagcagggtgagaatgaaaaattagaggga gtaaataaatgcagtattatgtaa

DBGET integrated database retrieval system