Stomoxys calcitrans (stable fly): 131994225 Help Entry 131994225         CDS       T07664                                  Name (RefSeq) probable insulin-like peptide 3   KO K04526   insulin Organism scac  Stomoxys calcitrans (stable fly) Pathway scac04068   FoxO signaling pathway scac04081   Hormone signaling scac04140   Autophagy - animal scac04150   mTOR signaling pathway scac04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:scac00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     131994225    04150 mTOR signaling pathway     131994225   09133 Signaling molecules and interaction    04081 Hormone signaling     131994225  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131994225  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     131994225  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:scac04052]     131994225 Cytokines and neuropeptides [BR:scac04052]  Neuropeptides   Unclassified    131994225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  131994225 NCBI-ProteinID:  XP_059216784 LinkDB All DBs Position 1:complement(166187916..166188521) Genome browser AA seq 115 aa AA seqDB search MKFAAFFILLITFHGTMADEKQTRLCGTSLDQAMQIICAETGLNTKTKKSANYLESSSLS ETLDPMTALTGILLREEANMMAKIRRRRDGIVDECCKYKGCTMNELLAYCKPKNE NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaaatttgctgcgttttttattcttctgattactttccatgggaccatggccgatgaa aaacaaactcgtctctgtggaaccagtttggatcaggcgatgcagataatatgtgcagaa acaggtctaaatacgaaaaccaaaaagtcagcaaattatttggaatcaagttccttatct gaaacgcttgatccgatgaccgctctaactggcattctactcagagaagaagccaatatg atggctaaaatccgcaggcgccgtgatggtattgtcgacgagtgctgcaaatataaaggt tgtacaatgaatgagctgttggcctattgcaaaccaaaaaacgagtaa

DBGET integrated database retrieval system