Stomoxys calcitrans (stable fly): 131998492 Help Entry 131998492         CDS       T07664                                  Name (RefSeq) probable insulin-like peptide 1   KO K04526   insulin Organism scac  Stomoxys calcitrans (stable fly) Pathway scac04068   FoxO signaling pathway scac04081   Hormone signaling scac04140   Autophagy - animal scac04150   mTOR signaling pathway scac04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:scac00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     131998492    04150 mTOR signaling pathway     131998492   09133 Signaling molecules and interaction    04081 Hormone signaling     131998492  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131998492  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     131998492  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:scac04052]     131998492 Cytokines and neuropeptides [BR:scac04052]  Neuropeptides   Unclassified    131998492 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  131998492 NCBI-ProteinID:  XP_059226760 LinkDB All DBs Position 1:complement(166275652..166276261) Genome browser AA seq 120 aa AA seqDB search MKILSVLLLFAALYEINGSRFCGPTLTQVLEMVCYNGYNPMIMSKKSSNKSVHHDMDIPD KFNEIDDVSGLKPDSLLNDLLYGNHVNRLAKTRRHRHLGGVYDECCRKDCTLDELAGYCL NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgaaaatactaagcgttcttctattgttcgctgctttgtacgaaattaacggctcgcgg ttttgtggccctacgctgacacaagtattagaaatggtctgttataatggctataaccca atgataatgagtaaaaaatccagcaataagtccgtgcaccatgatatggacattccggac aaattcaacgaaatcgatgatgtgtcaggtttaaaacccgattctcttctaaatgatttg ctatatggtaaccatgtcaacagactggccaaaacacgtagacaccggcatttgggtgga gtttacgatgaatgctgccgcaaagattgcaccctggatgaattggccggatattgcttg taa

DBGET integrated database retrieval system