Streptomyces cadmiisoli: DN051_14470 Help Entry DN051_14470       CDS       T07301                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism scad  Streptomyces cadmiisoli Brite KEGG Orthology (KO) [BR:scad00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     DN051_14470 Enzymes [BR:scad01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      DN051_14470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Glrx-like Thioredoxin GST_N_3 Motif Other DBs NCBI-ProteinID:  AWW37708 UniProt:  A0A2Z4IYM8 LinkDB All DBs Position 3434498..3434740 Genome browser AA seq 80 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKSQMDREGIAYTEINIEQDPESAVFVEKANGGNQTVPTVLF PDGSTLTNPSLAQVKQKIGA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccgggcactgtgacgatgtacagcaccacgtggtgcggatactgccgtcggctgaag agccagatggaccgcgagggcattgcgtacacggagatcaacatcgagcaggacccggag tccgcggtgttcgtggagaaggcgaacggcggcaaccagacggtgccgaccgtgctgttc ccggacgggtcgacgctgaccaacccgtcgctggcgcaggtcaagcagaagatcggcgcc tag

DBGET integrated database retrieval system