Streptomyces cadmiisoli: DN051_33945 Help Entry DN051_33945       CDS       T07301                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scad  Streptomyces cadmiisoli Pathway scad00998   Biosynthesis of various antibiotics scad01100   Metabolic pathways scad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scad00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DN051_33945    00074 Mycolic acid biosynthesis     DN051_33945   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DN051_33945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding RAD51D_N Motif Other DBs NCBI-ProteinID:  AWW41063 UniProt:  A0A2Z4J9H5 LinkDB All DBs Position 7702485..7702760 Genome browser AA seq 91 aa AA seqDB search MTSPDNTTTSPETLRALEEVYAAVKRVRRDLRPSDRIVQDLEIDSLATLEILLGLEERFQ VSLVDNVRAAGVTTVGDLVALLDELRAGRPS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt ttgaccagtcctgacaacaccacgacgtcccccgagacgctcagggcactggaggaggtc tacgccgcggtgaaacgggtccggcgggacctgcggccgtcggaccggatcgtccaggac ctggagatcgactcgctcgccacgctggagatcctgctcggtctggaggagcgcttccag gtgtccttggtggacaacgtccgggcggccggggtgacgacggtgggcgacctggtcgca ctgctggacgaactgcgcgccggccgcccctcctga

DBGET integrated database retrieval system