Streptomyces caniscabiei: IHE65_31465 Help Entry IHE65_31465       CDS       T08931                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scae  Streptomyces caniscabiei Pathway scae00998   Biosynthesis of various antibiotics scae01100   Metabolic pathways scae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IHE65_31465    00074 Mycolic acid biosynthesis     IHE65_31465   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IHE65_31465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WEO27313 LinkDB All DBs Position complement(7089293..7089541) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLADIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATDYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacccaggaagagatcgtcgccggtctcgccgacatcgtgaacgagatcgcc ggcatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctcaagacggtcggcgacgcgaccgactacatcctcaagcac cagggctga

DBGET integrated database retrieval system