Streptomyces caniscabiei: IHE65_39925 Help Entry IHE65_39925       CDS       T08931                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scae  Streptomyces caniscabiei Pathway scae00261   Monobactam biosynthesis scae01100   Metabolic pathways scae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scae00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IHE65_39925  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scae01008]     IHE65_39925 Polyketide biosynthesis proteins [BR:scae01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IHE65_39925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WEO28853 LinkDB All DBs Position 9059487..9059696 Genome browser AA seq 69 aa AA seqDB search MTNPFENPDGTYLVLVNDEGQHSLWPDFTAVPAGWTTAFGPESRTACLEYVEREWTDLRP KSLVRAMGE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgagaaccccgacggcacctacctggtcctggtcaacgacgagggc cagcactcgctgtggcccgacttcaccgccgtgcccgccggctggaccaccgccttcggc ccggagagccgcaccgcctgcctggagtacgtcgaacgcgagtggaccgacctgcggccc aagagcctcgtccgggccatgggcgagtga

DBGET integrated database retrieval system