Streptococcus canis: NCTC12191_01015 Help Entry NCTC12191_01015   CDS       T07143                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism scai  Streptococcus canis Pathway scai01100   Metabolic pathways scai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC12191_01015 (acpP)    00074 Mycolic acid biosynthesis     NCTC12191_01015 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC12191_01015 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  VEE24832 LinkDB All DBs Position 1:992966..993190 Genome browser AA seq 74 aa AA seqDB search MAVFEKVQEIIVEELGKETEEVTLETTFDDLDADSLDVFQVISEIEDAFDIQIETEEGLN TVGDLVAYVEEKTK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgaaaaagtacaagaaattatcgttgaggaacttggtaaggaaacagaa gaagtgactttggaaacaacttttgatgatcttgacgcagattcacttgatgttttccaa gttatctcagagattgaagatgcctttgatatccaaattgaaactgaagaaggcttgaac actgttggtgaccttgttgcttacgttgaagagaaaacaaaataa

DBGET integrated database retrieval system