Streptococcus canis: NCTC12191_01208 Help Entry NCTC12191_01208   CDS       T07143                                  Name (GenBank) transposase of IS200 family   KO K07491   REP-associated tyrosine transposase Organism scai  Streptococcus canis Brite KEGG Orthology (KO) [BR:scai00001]  09190 Not Included in Pathway or Brite   09192 Unclassified: genetic information processing    99976 Replication and repair     NCTC12191_01208 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Y1_Tnp Motif Other DBs NCBI-ProteinID:  VEE25009 LinkDB All DBs Position 1:complement(1193066..1193200) Genome browser AA seq 44 aa AA seqDB search MAQKAHSLSHTKWMCKYHIVFTPKYRRKVIYNQYRNSLGEIFRR NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcacaaaaggcacatagtttatcacacacaaagtggatgtgtaaatatcacattgtg tttacacctaagtatagacgaaaagttatttataatcaatatagaaacagtttaggcgag atatttcgccgatga

DBGET integrated database retrieval system