Streptomyces camelliae: O1G22_04430 Help Entry O1G22_04430       CDS       T10340                                  Name (GenBank) tautomerase family protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism scaj  Streptomyces camelliae Pathway scaj00362   Benzoate degradation scaj00621   Dioxin degradation scaj00622   Xylene degradation scaj01100   Metabolic pathways scaj01120   Microbial metabolism in diverse environments scaj01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:scaj00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     O1G22_04430    00622 Xylene degradation     O1G22_04430    00621 Dioxin degradation     O1G22_04430 Enzymes [BR:scaj01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      O1G22_04430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Motif Other DBs NCBI-ProteinID:  WBO62130 LinkDB All DBs Position 923692..923907 Genome browser AA seq 71 aa AA seqDB search MPFANFKVPAGSLDEQQKELIVTRATELYVEIYGERARAATMVLVEEVADGGWGIGGGVL TLARLREPAQD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgccgttcgcgaatttcaaggtgcccgccggaagcctggacgagcagcagaaggagctg atcgtcacccgcgccaccgagctgtacgtcgagatctacggagagcgggcccgcgccgcc acgatggtcctggtggaggaggtcgccgacggcggctggggcatcgggggcggcgtgctg accctggccaggctccgggagccggcgcaggattga

DBGET integrated database retrieval system