Streptomyces camelliae: O1G22_29060 Help Entry O1G22_29060       CDS       T10340                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scaj  Streptomyces camelliae Pathway scaj00998   Biosynthesis of various antibiotics scaj01100   Metabolic pathways scaj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scaj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     O1G22_29060    00074 Mycolic acid biosynthesis     O1G22_29060   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     O1G22_29060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WBO66566 LinkDB All DBs Position complement(6347928..6348176) Genome browser AA seq 82 aa AA seqDB search MAATEKEIVDGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATEYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactgagaaggagatcgtcgacggtctcgccgagatcgtgaacgagatcgcc gggatccccgtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgaggacgtcaagaacctcaagacggtcggcgacgcgaccgagtacatcctcaagcac caggcctga

DBGET integrated database retrieval system