Streptomyces camelliae: O1G22_42315 Help Entry O1G22_42315       CDS       T10340                                  Name (GenBank) tautomerase family protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism scaj  Streptomyces camelliae Pathway scaj00362   Benzoate degradation scaj00621   Dioxin degradation scaj00622   Xylene degradation scaj01100   Metabolic pathways scaj01120   Microbial metabolism in diverse environments scaj01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:scaj00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     O1G22_42315    00622 Xylene degradation     O1G22_42315    00621 Dioxin degradation     O1G22_42315 Enzymes [BR:scaj01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      O1G22_42315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase DUF7323 Motif Other DBs NCBI-ProteinID:  WBO68949 LinkDB All DBs Position complement(9186957..9187199) Genome browser AA seq 80 aa AA seqDB search MPVITVDWWQGNDRERRADLVSELAATASRVTGCPIDDVTVIVRDCEPGHASGLRDGRSR TACPGANGFGEMGLGQGSPC NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgcctgtgatcaccgttgattggtggcaggggaacgaccgggaacgccgggcggacctc gtgtccgagctggccgccaccgcctcccgggtgaccgggtgtccgatcgacgacgtgacc gtcatcgtgcgggactgcgagcccggccatgcctccgggctgcgcgacggccgctccaga accgcgtgccccggtgcgaacggcttcggtgagatgggcctggggcagggcagtccctgc tga

DBGET integrated database retrieval system