Streptomyces californicus: I6J39_09320 Help Entry I6J39_09320       CDS       T07611                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scal  Streptomyces californicus Pathway scal00998   Biosynthesis of various antibiotics scal01100   Metabolic pathways scal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6J39_09320    00074 Mycolic acid biosynthesis     I6J39_09320   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6J39_09320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QRV27498 LinkDB All DBs Position 2104992..2105240 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVKGLAEIVNEIAGIPEEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcaagggtctcgccgagatcgtcaacgagatcgcc ggtatcccggaggaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgccgccgactacatcctgaagcac cagggctga

DBGET integrated database retrieval system