Serinus canaria (common canary): 103815784 Help Entry 103815784         CDS       T05755                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism scan  Serinus canaria (common canary) Pathway scan04145   Phagocytosis scan04814   Motor proteins scan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:scan00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     103815784 (DYNLT3)   09142 Cell motility    04814 Motor proteins     103815784 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103815784 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:scan03037]     103815784 (DYNLT3)    04812 Cytoskeleton proteins [BR:scan04812]     103815784 (DYNLT3) Cilium and associated proteins [BR:scan03037]  Motile cilia and associated proteins   Dynein arm    103815784 (DYNLT3) Cytoskeleton proteins [BR:scan04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      103815784 (DYNLT3) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 PBS_linker_poly Motif Other DBs NCBI-GeneID:  103815784 NCBI-ProteinID:  XP_030090874 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEEFHPHNDEMIFNADEAHNIVKECIENVLGKADYNQNKVNQWTAAIVEQSLTHLVKLGK TYKYIVTCAVMQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtttcacccccacaacgatgagatgatcttcaatgctgatgaggcccacaac atagttaaggagtgcatagagaatgttttaggcaaggcagattataatcaaaacaaagtc aaccaatggactgctgctatagtagaacagtcactgacccatctggtgaaacttgggaaa acctataagtacattgttacctgtgcagtgatgcagaggagtggagctggtcttcacaca gcaagctcatgcttctgggataccacaactgatggaacctgcacagtgagatgggaaaac cgaaccatgaactgcattgtcaatgtgtttgctgttgctattatcctgtag

DBGET integrated database retrieval system