Serinus canaria (common canary): 103820086 Help Entry 103820086         CDS       T05755                                  Name (RefSeq) C-C motif chemokine 5-like   KO K05408   C-C motif chemokine 3 Organism scan  Serinus canaria (common canary) Pathway scan04060   Cytokine-cytokine receptor interaction scan04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:scan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103820086  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103820086  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:scan04052]     103820086    00536 Glycosaminoglycan binding proteins [BR:scan00536]     103820086 Cytokines and neuropeptides [BR:scan04052]  Cytokines   Chemokines    103820086 Glycosaminoglycan binding proteins [BR:scan00536]  Heparan sulfate / Heparin   Chemokines    103820086 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  103820086 NCBI-ProteinID:  XP_009092947 UniProt:  A0A8C9MVW3 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKVLAATLATLLLLATCSPAEGHLDGVPSTCCFSYQRQPIPRRRVSSVFVTSSSCSQPGV IVVTQKKKQLCADPRAAWVQQLLKHFQSLEN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcctggcagccaccctggccactctgctcctcctggccacctgctccccagct gaaggtcacctcgatggtgtccccagcacctgctgcttcagctaccagaggcagcccatc cctcggcgccgcgtcagctccgtctttgtcaccagcagctcctgcagccagccaggagtg attgtggtcacccagaagaagaagcagctgtgtgcagatccacgggcagcatgggtgcag cagctcctgaagcacttccagagcctggaaaactga

DBGET integrated database retrieval system