KEGG   Serinus canaria (common canary): 103820949
Entry
103820949         CDS       T05755                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
scan  Serinus canaria (common canary)
Pathway
scan04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103820949 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:scan04050]
    103820949 (TNFRSF8)
   04090 CD molecules [BR:scan04090]
    103820949 (TNFRSF8)
Cytokine receptors [BR:scan04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103820949 (TNFRSF8)
CD molecules [BR:scan04090]
 Proteins
  103820949 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 DUF4349
Other DBs
NCBI-GeneID: 103820949
NCBI-ProteinID: XP_030086458
LinkDB
Position
Unknown
AA seq 442 aa
MAACSLPLALGLLLLLQDIQTTPQTSLTPPHSCDTLENWFYDETSQNCCYQCPSGYVKKK
ACPRDPAADCMTCGPEQYLNNKFKKPQCDACVSCSKAAGLALGVKTRGTSTNDVTCEECP
PGTFSDQSSSTDTCKPHTNCAKLNKVMLRKGNATHDQVCLEQLPTYLTPSTLSIRFSNET
KNFDLRMLKENLVTSASGDLLSVTATENPSSTPEEEAQAPTSAKGEMATGGLVLWAVVLS
LAVLLGAMLVFWKWKVCKKRILVLRRKPHLHSVIAHKYVLKSPGSDLVNKCAKIILTTES
GLEEEELIDRTLPLETNNNLVSSTEKAQSPHWSVPDVTPSSGSAPDCPVDSRVRDHTNNR
IEKLYIMKADTVIVGSVKEVPSGKNCAAKGCESNLDAQESTEEELGMHYPEQETESFPGN
DGMVPVEEEGKEFHHPTTATEK
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggctgcctgcagcctgcctctggcactggggctcctgctgctgctccaggacatccag
acaacccctcagacatcattaaccccacctcattcctgtgatacactagagaattggttc
tatgatgaaacctcacaaaactgctgttaccagtgtccctcaggctatgttaaaaagaaa
gcatgtcctcgggacccagctgcagactgcatgacatgtggacctgagcagtatttgaac
aataaattcaaaaagccacaatgtgatgcctgtgtgtcatgctcaaaagctgcaggcctg
gctttgggggtcaaaaccaggggcacctcaacaaacgatgtgacttgtgaagagtgccct
cctgggaccttctctgatcaaagctccagcacagacacctgcaaaccccacaccaactgt
gccaagttgaacaaagtaatgctgaggaaaggaaatgctacacacgatcaagtttgcctg
gagcagctgcccacctacctcaccccaagcactttgtccatcagattcagcaatgagaca
aagaactttgacctgaggatgctgaaggagaacctggtgacctctgccagtggtgacctt
ctaagtgtcacagcaactgagaatcccagttcaactccagaggaggaagctcaggctcca
acctcagccaagggggagatggcaacaggaggtctggtgctttgggcagtggttctctcc
ctggcagtgcttcttggggccatgctggtgttttggaaatggaaggtttgcaagaagagg
atcctggtcctcaggagaaagccacacctgcactcggtcatcgcacacaaatacgtgctc
aagtctccaggttcggatcttgtgaacaaatgtgcaaagatcatactgaccactgagagt
gggctggaagaggaggagctcattgacaggacccttcctttggaaaccaacaataacttg
gtgtccagcacagaaaaagcccagagtcctcactggagtgtgcctgatgtgacaccaagc
agtggcagtgccccagactgccctgtggattctcgagtcagagaccacacaaataacaga
attgaaaagctctacatcatgaaggccgacactgtcatcgtgggctctgttaaagaagtg
cccagtggcaagaactgtgctgctaaaggatgtgaaagtaaccttgatgcccaggaaagc
acagaggaggaactgggaatgcactacccagagcaggaaacagagtcttttccaggcaat
gatggaatggtgccagtggaagaggagggaaaggaatttcaccaccctaccactgccact
gagaagtga

DBGET integrated database retrieval system