Serinus canaria (common canary): 103821471 Help Entry 103821471         CDS       T05755                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism scan  Serinus canaria (common canary) Pathway scan04068   FoxO signaling pathway scan04136   Autophagy - other scan04140   Autophagy - animal scan04621   NOD-like receptor signaling pathway scan04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:scan00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     103821471 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103821471 (ATG12)    04136 Autophagy - other     103821471 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103821471 (ATG12)    04622 RIG-I-like receptor signaling pathway     103821471 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:scan04131]     103821471 (ATG12)    04121 Ubiquitin system [BR:scan04121]     103821471 (ATG12)    03029 Mitochondrial biogenesis [BR:scan03029]     103821471 (ATG12) Membrane trafficking [BR:scan04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     103821471 (ATG12) Ubiquitin system [BR:scan04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    103821471 (ATG12) Mitochondrial biogenesis [BR:scan03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     103821471 (ATG12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  103821471 NCBI-ProteinID:  XP_030093189 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MAEPEEQPPPAAAQSGGRSDGGDEAPESGTAAGPAEPGPPPAGSPGTEEPAGDAKKKIDV LLKAVGDTPIMRTKKWAVERTRTIQGLVDFIKKFLKLMASEQLFIYVNQSFAPSPDQEVG TLYECFGSDGKLVLHYCKTQAWG NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggcggagcccgaggagcagccgccgcccgccgcggcgcagagcggcggccggagcgat ggcggtgatgaagctccggagagcgggaccgcggcggggcccgccgaaccgggcccaccc ccggccgggtcgccgggcaccgaagagcccgcgggcgacgcgaaaaagaaaattgacgtg ctgctgaaggccgtgggcgacacccccatcatgaggaccaagaagtgggcggtggagcgg acccggaccatccagggcctcgtggacttcatcaagaagttcctcaagctgatggcttcc gaacagctgttcatatatgtaaaccagtcttttgctccatctccagaccaagaagtgggg accctctatgagtgttttggaagtgatggcaagcttgtactgcattattgcaaaactcag gcttggggatga

DBGET integrated database retrieval system