Serinus canaria (common canary): 103823472 Help Entry 103823472         CDS       T05755                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism scan  Serinus canaria (common canary) Pathway scan04060   Cytokine-cytokine receptor interaction scan04218   Cellular senescence scan04620   Toll-like receptor signaling pathway scan04621   NOD-like receptor signaling pathway scan04622   RIG-I-like receptor signaling pathway scan05132   Salmonella infection scan05164   Influenza A Brite KEGG Orthology (KO) [BR:scan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103823472  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     103823472  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103823472    04621 NOD-like receptor signaling pathway     103823472    04622 RIG-I-like receptor signaling pathway     103823472  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     103823472   09171 Infectious disease: bacterial    05132 Salmonella infection     103823472  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:scan04052]     103823472    00536 Glycosaminoglycan binding proteins [BR:scan00536]     103823472 Cytokines and neuropeptides [BR:scan04052]  Cytokines   Chemokines    103823472 Glycosaminoglycan binding proteins [BR:scan00536]  Heparan sulfate / Heparin   Chemokines    103823472 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103823472 NCBI-ProteinID:  XP_009096796 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MTGKAVAAVLILLLISALGTQGELMPRSAIELRCQCISTHSKFIHPKFIQNVNLTPSGPH CKNVEVIATLRDGREVCLEPSAPWVKLIIKAILDKANTKPETVF NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgactggcaaggctgtggctgccgtgctgatcctgctcctgatctcagcacttggaaca caaggtgagctgatgccacgctcggccatcgaactccggtgccagtgcataagcacccat tccaaattcatccatcccaagttcatccaaaacgtgaacctcacccccagcggacctcac tgcaagaatgttgaagtcatagctaccttgagagatggcagagaagtgtgcctggagccc agtgctccttgggtgaagctgatcatcaaggcaattctggacaaggccaacaccaaacct gagacagtgttctaa

DBGET integrated database retrieval system