Serinus canaria (common canary): 103824010
Help
Entry
103824010 CDS
T05755
Name
(RefSeq) SLAM family member 5
KO
K06479
CD48 antigen
Organism
scan
Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:
scan00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04515 Cell adhesion molecules [BR:
scan04515
]
103824010
04090 CD molecules [BR:
scan04090
]
103824010
00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:
scan00537
]
103824010
Cell adhesion molecules [BR:
scan04515
]
Immunoglobulin superfamily
SLAM/CD2 family
103824010
CD molecules [BR:
scan04090
]
Proteins
103824010
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:
scan00537
]
Receptors
103824010
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
ig
Motif
Other DBs
NCBI-GeneID:
103824010
NCBI-ProteinID:
XP_030086235
LinkDB
All DBs
Position
Unknown
AA seq
171 aa
AA seq
DB search
MAPGLVLNLLLFLLFLLFATPGIVPELQGDFVPSWALSQSSRGTLCHPGLSAALVPKPRV
TATTSGDPQVCNATLSCSVALQGVTYEWIPPQKVVRKEGPVLEVSINPAVETYVCKVSNP
VSSSSASLTFRRPCTWTEESSSAASRATPSAPVALGHLLLLLLLLLLLTVA
NT seq
516 nt
NT seq
+upstream
nt +downstream
nt
atggcaccggggctggtgttgaacctcctcctcttcctcctcttcctcctcttcgccaca
ccagggattgtcccagagctccagggggactttgtgccatcctgggcactgtcccagagc
tccagggggactttgtgccaccctggcctctctgcagccctggtcccgaagccccgcgtg
acggccaccaccagcggtgacccccaggtgtgcaacgccaccctgagctgctccgtggcc
ctccagggggtcacctacgagtggatcccgccccagaaggtggtgaggaaggagggcccc
gtcctggaggtctccatcaaccccgcggtggaaacctacgtctgcaaggtcagcaacccc
gtgtcctccagctccgcctcgctgaccttccggcgcccctgcacctggacagaggaatcc
tcctcggccgcctcccgcgccacgcccagcgccccggtggccctgggacacctcctcctc
ctcctcctcctcctcctcctgctcaccgtggcttga
DBGET
integrated database retrieval system