Serinus canaria (common canary): 103824883 Help Entry 103824883         CDS       T05755                                  Name (RefSeq) josephin-2-like   KO K15235   josephin [EC:3.4.19.12] Organism scan  Serinus canaria (common canary) Brite KEGG Orthology (KO) [BR:scan00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:scan01002]     103824883   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:scan04121]     103824883 Enzymes [BR:scan01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.19  Omega peptidases     3.4.19.12  ubiquitinyl hydrolase 1      103824883 Peptidases and inhibitors [BR:scan01002]  Cysteine peptidases   Family C86    103824883 Ubiquitin system [BR:scan04121]  Deubiquitinating enzyme (DUB)   Ubiquitin-specific proteases (UBPs)    MJD     103824883 SSDB OrthologParalogGFIT Motif Pfam:  Josephin Motif Other DBs NCBI-GeneID:  103824883 NCBI-ProteinID:  XP_018780971 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search NSRPNPHRSLLGTGNYDVNVVMAALGTLGLAAVWWDKRRPLERLCLSHVLGFLLNVPSRV ALGTLALPLSRPHWLCVRPFGGTFYNLDSKLATPTPIGAEPQLR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt aattctcggcccaacccccaccggagcctgctgggcacgggcaattatgacgtcaacgtg gtgatggcggcgctgggcacgctggggctggcggcggtctggtgggacaagcggcgcccc ctggagcgcctgtgcctgtcccacgtgctgggcttcctgctcaatgtcccctcccgggtg gccttggggacattggcactgccactgtcccgcccccactggctctgcgtgcgacccttt gggggcaccttctacaacctggactccaaactggccacgcccacccccatcggggcggag cctcagctcaggtga

DBGET integrated database retrieval system