Serinus canaria (common canary): 103825167 Help Entry 103825167         CDS       T05755                                  Symbol UXT Name (RefSeq) protein UXT   KO K26537   protein UXT Organism scan  Serinus canaria (common canary) Brite KEGG Orthology (KO) [BR:scan00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:scan03036]     103825167 (UXT)    03029 Mitochondrial biogenesis [BR:scan03029]     103825167 (UXT) Chromosome and associated proteins [BR:scan03036]  Eukaryotic type   Histone modification proteins    Other histone modification proteins     103825167 (UXT) Mitochondrial biogenesis [BR:scan03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     103825167 (UXT) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prefoldin Motif Other DBs NCBI-GeneID:  103825167 NCBI-ProteinID:  XP_009098705 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAEKAQRYEAFVSDVLQRDLRRVQEQRDAIFEQQAQVLQLRSALTRLQDAAAPLRTQV DLGCNFFVNAEVPDPRRVFVALGFGFFAELTLPEALRHLERRSSLLQR NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggagaaggcgcagcgctacgaggcgttcgtcagcgacgtcctgcagcgc gacctgaggcgggtgcaggagcagcgcgacgccatcttcgagcagcaggcgcaggtgctg cagctccgctccgccctcacccgcctgcaggatgccgccgcccccctgcgcacccaggtg gatctcggctgcaatttcttcgtcaacgccgaagtcccggacccccggcgcgttttcgtg gctctgggttttgggttcttcgcggagctgacgctgcccgaggccctccggcacctggag cgccgcagctccctcctgcagaggtga

DBGET integrated database retrieval system