Serinus canaria (common canary): 115484025 Help Entry 115484025         CDS       T05755                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism scan  Serinus canaria (common canary) Brite KEGG Orthology (KO) [BR:scan00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:scan03019]     115484025    03029 Mitochondrial biogenesis [BR:scan03029]     115484025 Messenger RNA biogenesis [BR:scan03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      115484025 Mitochondrial biogenesis [BR:scan03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     115484025 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  115484025 NCBI-ProteinID:  XP_030083285 LinkDB All DBs Position Unknown AA seq 63 aa AA seqDB search MDSQDCPCATGGTCTCGDNCKCKNCKCTSCKKGCCSCCPAGCAKCAQGCVCKGPPSAKCS CCK NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggactctcaggactgcccttgtgccacaggaggcacctgcacctgcggggacaactgt aaatgcaaaaactgtaaatgcacatcgtgcaaaaaaggctgctgctcctgctgcccagct ggatgtgccaagtgtgcacagggctgcgtctgcaaggggcccccctccgccaagtgcagc tgctgcaaatag

DBGET integrated database retrieval system