Staphylococcus caprae: DWB96_08225 Help Entry DWB96_08225       CDS       T06252                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scar  Staphylococcus caprae Pathway scar01100   Metabolic pathways scar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DWB96_08225    00074 Mycolic acid biosynthesis     DWB96_08225   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DWB96_08225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  QDW94201 LinkDB All DBs Position complement(1732804..1733037) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKYINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagtaaaagacatcatcgttgaccgtttaggtgtagatgctgat aaagtaactgaagatgcatctttcaaagatgatttaggcgctgactcacttgatatcgct gaattagtaatggaattagaagacgaatttggtactgaaattcctgatgaagaagctgaa aaaatcaacactgttggtgatgctgttaagtacatcaatagcttggaaaaataa

DBGET integrated database retrieval system