Streptomyces cavourensis: CVT27_18220 Help Entry CVT27_18220       CDS       T07023                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism scav  Streptomyces cavourensis Pathway scav00253   Tetracycline biosynthesis scav01056   Biosynthesis of type II polyketide backbone scav01100   Metabolic pathways scav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scav00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     CVT27_18220    00253 Tetracycline biosynthesis     CVT27_18220  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:scav01004]     CVT27_18220    01008 Polyketide biosynthesis proteins [BR:scav01008]     CVT27_18220 Lipid biosynthesis proteins [BR:scav01004]  Polyketide synthase   Component type    CVT27_18220 Polyketide biosynthesis proteins [BR:scav01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      CVT27_18220     Nonaketide PKS      CVT27_18220     Decaketide PKS      CVT27_18220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ATY97165 LinkDB All DBs Position 4119817..4120125 Genome browser AA seq 102 aa AA seqDB search MDTTGTVTATTTDEHSGAFTLENLKRILREGAGADESVDFDGDILDTDFEELGYESLALL ETCGRIEREYGITLDDSVVGDVRTPRRMVEVVNEHLDRVTPA NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggacaccaccggtacggtcacggcgaccaccacggacgaacactccggggccttcacc ctggagaacctcaagcgcatcctccgcgagggcgcgggcgccgacgagagcgtcgacttc gacggcgacatcctcgacacggacttcgaggagctgggctacgagtccctggcgctcctg gagacctgcggccggatcgagcgcgaatacggcatcaccctcgacgactcggtggtcggc gacgtccggaccccgcgccgcatggtcgaggtcgtgaacgagcacctggaccgggtgacc ccggcctga

DBGET integrated database retrieval system