Streptomyces cavourensis: CVT27_23060 Help Entry CVT27_23060       CDS       T07023                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism scav  Streptomyces cavourensis Brite KEGG Orthology (KO) [BR:scav00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CVT27_23060 Enzymes [BR:scav01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CVT27_23060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Thioredoxin_2 Glrx-like Thioredoxin GST_N_2 Motif Other DBs NCBI-ProteinID:  ATY98012 LinkDB All DBs Position complement(5179971..5180225) Genome browser AA seq 84 aa AA seqDB search MAGTVTMYSTTWCGYCRRLKSQMDREGIAYNEVNIEHDPESAAFVEKANGGNQTVPTLLI VSPAGTESVMTNPSLAQVKQALVA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcgggcactgtgacgatgtacagcaccacctggtgcggctactgccgtcggctgaag agccagatggaccgcgagggcatcgcgtacaacgaggtcaacatcgagcacgacccggag tcggcggcgttcgtcgagaaggccaatggcggaaaccagacggttccgacgctgctgatc gtctcccccgcgggcaccgagtcggtcatgacgaacccgtcgctggcccaggtgaagcag gccctggtggcctga

DBGET integrated database retrieval system