Streptomyces scabiei: SCAB_28811 Help Entry SCAB_28811        CDS       T01187                                  Symbol atpE Name (GenBank) ATP synthase C chain   KO K02110   F-type H+-transporting ATPase subunit c Organism scb  Streptomyces scabiei Pathway scb00190   Oxidative phosphorylation scb01100   Metabolic pathways Module scb_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:scb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SCAB_28811 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:scb00194]     SCAB_28811 (atpE) Photosynthesis proteins [BR:scb00194]  Photosystem and electron transport system   F-type ATPase [OT]    SCAB_28811 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  CBG69980 UniProt:  C9Z8F3 LinkDB All DBs Position complement(3282782..3283015) Genome browser AA seq 77 aa AA seqDB search MAAMETLAALEGNIGSVGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLIRANQILGFA FCEALALIGIVMPFVYN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggctgccatggagaccctcgccgcccttgaaggcaacatcggttccgtcggctacggc ctcgccgccatcggccccggcgtcggcgtcggcatcatcttcggtaacggcacccaggcc ctggcccgccagcccgaggccgccggtctgatccgtgccaaccagatcctcggcttcgcc ttctgtgaggcgctcgccctcatcggcatcgtcatgcccttcgtctacaactga

DBGET integrated database retrieval system