Streptomyces scabiei: SCAB_36301 Help Entry SCAB_36301        CDS       T01187                                  Symbol groS Name (GenBank) 10 kD chaperonin cpn10   KO K04078   chaperonin GroES Organism scb  Streptomyces scabiei Brite KEGG Orthology (KO) [BR:scb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:scb03110]     SCAB_36301 (groS)    03029 Mitochondrial biogenesis [BR:scb03029]     SCAB_36301 (groS) Chaperones and folding catalysts [BR:scb03110]  Heat shock proteins   HSP10    SCAB_36301 (groS) Mitochondrial biogenesis [BR:scb03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     SCAB_36301 (groS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  CBG70719 UniProt:  C9YUY5 LinkDB All DBs Position complement(4106604..4106912) Genome browser AA seq 102 aa AA seqDB search MTTTSSKVAIKPLEDRIVVQPLDAEQTTASGLVIPDTAKEKPQEGVILAVGPGRFENGER LPLDVKVGDIVLYSKYGGTEVKYNGEEYLVLSSRDVLAVIEK NT seq 309 nt NT seq  +upstreamnt  +downstreamnt gtgacgaccaccagctccaaggttgccatcaagccgctcgaggaccgcattgtggtccag ccgctcgacgccgagcagaccaccgcctctggcctggtcattccggacaccgcgaaggag aagccccaggagggcgtcatcctcgccgtgggtccgggccgcttcgagaacggcgagcgc ctgccgctcgacgtgaaggtcggcgacatcgtgctgtacagcaagtacggcggcaccgag gtgaagtacaacggcgaggagtacctcgtcctctcgtcccgcgacgtcctcgcggtcatc gagaagtaa

DBGET integrated database retrieval system