KEGG   Saccharomyces cerevisiae (budding yeast): YAR002W
Entry
YAR002W           CDS       T00005                                 
Symbol
NUP60
Name
(RefSeq) FG-nucleoporin NUP60
  KO
K18718  nucleoporin NUP60
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    YAR002W (NUP60)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YAR002W (NUP60)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YAR002W (NUP60)
SSDB
Motif
Pfam: Pilin_PilA
Other DBs
NCBI-GeneID: 851263
NCBI-ProteinID: NP_009401
SGD: S000000063
UniProt: P39705
LinkDB
Position
I:152257..153876
AA seq 539 aa
MHRKSLRRASATVPSAPYRKQIISNAHNKPSLFSKIKTFFTQKDSARVSPRNNVANKQPR
NESFNRRISSMPGGYFHSEISPDSTVNRSVVVSAVGEARNDIENKEEEYDETHETNISNA
KLANFFSKKGNEPLSEIEIEGVMSLLQKSSKSMITSEGEQKSAEGNNIDQSLILKESGST
PISISNAPTFNPKYDTSNASMNTTLGSIGSRKYSFNYSSLPSPYKTTVYRYSAAKKIPDT
YTANTSAQSIASAKSVRSGVSKSAPSKKISNTAAALVSLLDENDSKKNNAASELANPYSS
YVSQIRKHKRVSPNAAPRQEISEEETTVKPLFQNVPEQGEEPMKQLNATKISPSAPSKDS
FTKYKPARSSSLRSNVVVAETSPEKKDGGDKPPSSAFNFSFNTSRNVEPTENAYKSENAP
SASSKEFNFTNLQAKPLVGKPKTELTKGDSTPVQPDLSVTPQKSSSKGFVFNSVQKKSRS
NLSQENDNEGKHISASIDNDFSEEKAEEFDFNVPVVSKQLGNGLVDENKVEAFKSLYTF
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgcatcgtaaatcattgaggagggctagcgctactgtgccttccgctccctatcgaaag
cagattattagcaatgcacacaataaaccaagccttttctctaaaattaaaactttcttt
acccaaaaagattcagccagagtgagtccaaggaataatgttgctaataaacaaccacgc
aatgagtcttttaacagaagaatctcaagtatgcctggaggttatttccattctgagata
tccccagattctactgtaaaccgttccgtagttgtttctgcagtgggtgaagccagaaac
gacattgagaataaagaagaggagtatgatgaaacacatgaaactaacatctccaatgca
aagcttgcaaacttttttagtaaaaaaggtaatgagcctttatcagaaattgaaatagag
ggtgtgatgtcattgttacaaaaatcaagcaaatccatgataacttcggaaggagaacaa
aaatcagccgaaggtaataatatcgaccagtcgcttatcttgaaggagtcaggaagtaca
ccaatcagcatatctaatgcgccgaccttcaacccaaaatatgatacttcaaatgcgtca
atgaatacgactttgggaagcattggttcaagaaaatacagtttcaattattctagcctg
ccctcaccatacaaaacaaccgtttatagatatagtgcagcgaaaaagatccccgataca
tacacagccaacacatctgctcaaagtatagcatctgctaaatcggtaagaagtggtgtt
tcaaagtcagctcctagtaagaaaataagtaatacagctgcggcattggtctcactatta
gatgaaaatgacagtaagaagaataatgcagcttcagaacttgctaatccatactcctca
tatgtaagccaaatacgcaaacataagagagtttctccaaatgctgcaccaaggcaagag
atcagtgaagaagaaactactgttaagccattatttcaaaacgttcctgaacaaggcgaa
gaaccaatgaaacaactgaacgccaccaaaatttcaccatctgcgccaagcaaagattct
tttactaaatacaaacctgcaaggtcctcatccttacgctcaaatgtcgtcgtagctgaa
acctcacctgaaaagaaggatggtggagataaacctccatcctctgcttttaacttctcg
tttaatacttcaagaaacgttgaacctactgagaatgcttataagagcgagaacgcacca
tctgcatcatcaaaggaattcaattttaccaacctacaggcgaagccgttagttggaaag
ccaaaaaccgaacttacaaagggcgattctactcccgtccaaccagatctttcggttact
cctcaaaaaagttcatcgaaaggctttgtttttaatagtgttcaaaagaaatcacggtcc
aatctttcacaagaaaacgataatgaaggtaaacatatcagcgcctcaattgataacgac
ttttcagaggaaaaggcggaagagtttgatttcaatgttcccgtggtgtctaagcagcta
ggaaatggcttggttgatgaaaataaagttgaggctttcaagtccctatataccttttga

DBGET integrated database retrieval system