KEGG   Saccharomyces cerevisiae (budding yeast): YAR071W
Entry
YAR071W           CDS       T00005                                 
Symbol
PHO11
Name
(RefSeq) acid phosphatase PHO11
  KO
K23458  repressible acid phosphatase [EC:3.1.3.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00730  Thiamine metabolism
sce00740  Riboflavin metabolism
sce01100  Metabolic pathways
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    YAR071W (PHO11)
   00740 Riboflavin metabolism
    YAR071W (PHO11)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YAR071W (PHO11)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     YAR071W (PHO11)
SSDB
Motif
Pfam: His_Phos_2 DUF4918
Other DBs
NCBI-GeneID: 851299
NCBI-ProteinID: NP_009434
SGD: S000000094
UniProt: P35842
LinkDB
Position
I:225460..226863
AA seq 467 aa
MLKSAVYSILAASLVNAGTIPLGKLSDIDKIGTQTEIFPFLGGSGPYYSFPGDYGISRDL
PESCEMKQVQMVGRHGERYPTVSKAKSIMTTWYKLSNYTGQFSGALSFLNDDYEFFIRDT
KNLEMETTLANSVNVLNPYTGEMNAKRHARDFLAQYGYMVENQTSFAVFTSNSNRCHDTA
QYFIDGLGDKFNISLQTISEAESAGANTLSAHHSCPAWDDDVNDDILKKYDTKYLSGIAK
RLNKENKGLNLTSSDANTFFAWCAYEINARGYSDICNIFTKDELVRFSYGQDLETYYQTG
PGYDVVRSVGANLFNASVKLLKESEVQDQKVWLSFTHDTDILNYLTTIGIIDDKNNLTAE
HVPFMENTFHRSWYVPQGARVYTEKFQCSNDTYVRYVINDAVVPIETCSTGPGFSCEIND
FYDYAEKRVAGTDFLKVCNVSSVSNSTELTFFWDWNTKHYNDTLLKQ
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgttgaagtcagccgtttattcaattttagccgcttctttggttaatgcaggtaccata
cccctcggaaagttatctgacattgacaaaatcggaactcaaacggaaattttcccattt
ttgggtggttctgggccatactactctttccctggtgattatggtatttctcgtgatttg
ccggaaagttgtgaaatgaagcaagtgcaaatggttggtagacacggtgaaagatacccc
actgtcagcaaagccaaaagtatcatgacaacatggtacaaattgagtaactataccggt
caattcagcggagcattgtctttcttgaacgatgactacgaatttttcattcgtgacacc
aaaaacctagaaatggaaaccacacttgccaattcggtcaatgttttgaacccatatacc
ggtgagatgaatgctaagagacacgctcgtgatttcttggcgcaatatggctacatggtc
gaaaaccaaaccagttttgccgtttttacgtctaactcgaacagatgtcatgatactgcc
cagtatttcattgacggtttgggtgataaattcaacatatccttgcaaaccatcagtgaa
gccgagtctgctggtgccaatactctgagtgcccaccattcgtgtcctgcttgggacgat
gatgtcaacgatgacattttgaaaaaatatgataccaaatatttgagtggtattgccaag
agattaaacaaggaaaacaagggtttgaatctgacttcaagtgatgcaaacacttttttt
gcatggtgtgcatatgaaataaacgctagaggttacagtgacatctgtaacatcttcacc
aaagatgaattggtccgtttctcctacggccaagacttggaaacttattatcaaacggga
ccaggctatgacgtcgtcagatccgtcggtgccaacttgttcaacgcttcagtgaaacta
ctaaaggaaagtgaggtccaggaccaaaaggtttggttgagtttcacccacgataccgat
attctgaactatttgaccactatcggcataatcgatgacaaaaataacttgaccgccgaa
catgttccattcatggaaaacactttccacagatcctggtacgttccacaaggtgctcgt
gtttacactgaaaagttccagtgttccaatgacacctatgttagatacgtcatcaacgat
gctgtcgttccaattgaaacctgttctactggtccagggttctcctgtgaaataaatgac
ttctacgactatgctgaaaagagagtagccggtactgacttcctaaaggtctgtaacgtc
agcagcgtcagtaactctactgaattgacctttttctgggactggaataccaagcactac
aacgacactttattaaaacagtaa

KEGG   Saccharomyces cerevisiae (budding yeast): YBR093C
Entry
YBR093C           CDS       T00005                                 
Symbol
PHO5
Name
(RefSeq) acid phosphatase PHO5
  KO
K23458  repressible acid phosphatase [EC:3.1.3.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00730  Thiamine metabolism
sce00740  Riboflavin metabolism
sce01100  Metabolic pathways
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    YBR093C (PHO5)
   00740 Riboflavin metabolism
    YBR093C (PHO5)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBR093C (PHO5)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     YBR093C (PHO5)
SSDB
Motif
Pfam: His_Phos_2
Other DBs
NCBI-GeneID: 852390
NCBI-ProteinID: NP_009651
SGD: S000000297
UniProt: P00635
LinkDB
Position
II:complement(429548..430951)
AA seq 467 aa
MFKSVVYSILAASLANAGTIPLGKLADVDKIGTQKDIFPFLGGAGPYYSFPGDYGISRDL
PEGCEMKQLQMVGRHGERYPTVSLAKTIKSTWYKLSNYTRQFNGSLSFLNDDYEFFIRDD
DDLEMETTFANSDDVLNPYTGEMNAKRHARDFLAQYGYMVENQTSFAVFTSNSKRCHDTA
QYFIDGLGDQFNITLQTVSEAESAGANTLSACNSCPAWDYDANDDIVNEYDTTYLDDIAK
RLNKENKGLNLTSTDASTLFSWCAFEVNAKGYSDVCDIFTKDELVHYSYYQDLHTYYHEG
PGYDIIKSVGSNLFNASVKLLKQSEIQDQKVWLSFTHDTDILNFLTTAGIIDDKNNLTAE
YVPFMGNTFHRSWYVPQGARVYTEKFQCSNDTYVRYVINDAVVPIETCSTGPGFSCEIND
FYDYAEKRVAGTDFLKVCNVSSVSNSTELTFYWDWNTTHYNASLLRQ
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtttaaatctgttgtttattcaattttagccgcttctttggccaatgcaggtaccatt
cccttaggcaaactagccgatgtcgacaagattggtacccaaaaagatatcttcccattt
ttgggtggtgccggaccatactactctttccctggcgactatggtatttctcgtgatttg
cctgaaggttgtgaaatgaagcaactgcaaatggttggtagacatggtgaaagataccct
actgtcagtctggctaagactatcaagagtacatggtataagttgagcaattacactcgt
caattcaacggctcattgtcattcttgaacgatgattacgagtttttcatccgtgatgac
gatgatttggaaatggaaaccacttttgccaactcggacgatgttttgaacccatacact
ggtgaaatgaacgccaagagacatgctcgtgacttcttggctcaatacggttacatggtc
gaaaaccaaaccagtttcgccgtttttacctctaattctaagagatgtcatgacactgct
caatatttcattgatggtttaggtgaccaattcaacatcaccttgcagactgtcagtgaa
gctgaatccgctggtgccaacactttgagtgcttgtaactcatgtcctgcttgggactac
gatgccaatgatgacattgtaaatgaatacgacacaacctacttggatgacattgccaag
agattgaacaaggaaaacaagggtttgaacttgacctcaactgacgctagtactttattc
tcgtggtgtgcatttgaagtgaacgctaaaggttacagtgatgtctgtgatattttcacc
aaggatgaattagtccattactcctactaccaagacttgcacacttattaccatgagggt
ccaggttacgacattatcaagtctgtcggttccaacttgttcaatgcctcagtcaaatta
ttaaagcaaagtgagattcaagaccaaaaggtttggttgagttttacccacgataccgat
atcctaaactttttgaccaccgctggtataattgacgacaaaaacaacttaactgccgaa
tacgttccattcatgggcaacactttccacagatcctggtacgttcctcaaggtgctcgt
gtctacaccgaaaaattccaatgttctaacgacacctacgtcagatacgtcattaacgat
gctgttgttccaattgaaacctgttccactggtccagggttctcttgtgaaatcaatgac
ttctacgactatgctgaaaagagagtagccggtactgacttcctaaaggtctgtaacgtc
agcagcgtcagtaactctactgaattgaccttctactgggactggaacactactcattac
aacgccagtctattgagacaatag

KEGG   Saccharomyces cerevisiae (budding yeast): YHR215W
Entry
YHR215W           CDS       T00005                                 
Symbol
PHO12, PHO10
Name
(RefSeq) acid phosphatase PHO12
  KO
K23458  repressible acid phosphatase [EC:3.1.3.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00730  Thiamine metabolism
sce00740  Riboflavin metabolism
sce01100  Metabolic pathways
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    YHR215W (PHO12)
   00740 Riboflavin metabolism
    YHR215W (PHO12)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YHR215W (PHO12)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     YHR215W (PHO12)
SSDB
Motif
Pfam: His_Phos_2 DUF4918
Other DBs
NCBI-GeneID: 856625
NCBI-ProteinID: NP_012087
SGD: S000001258
UniProt: P38693
LinkDB
Position
VIII:552099..553502
AA seq 467 aa
MLKSAVYSILAASLVNAGTIPLGKLSDIDKIGTQTEIFPFLGGSGPYYSFPGDYGISRDL
PESCEMKQVQMVGRHGERYPTVSKAKSIMTTWYKLSNYTGQFSGALSFLNDDYEFFIRDT
KNLEMETTLANSVNVLNPYTGEMNAKRHARDFLAQYGYMVENQTSFAVFTSNSNRCHDTA
QYFIDGLGDKFNISLQTISEAESAGANTLSAHHSCPAWDDDVNDDILKKYDTKYLSGIAK
RLNKENKGLNLTSSDANTFFAWCAYEINARGYSDICNIFTKDELVRFSYGQDLETYYQTG
PGYDVVRSVGANLFNASVKLLKESEVQDQKVWLSFTHDTDILNYLTTIGIIDDQNNLTAE
HVPFMENTFHRSWYVPQGARVYTEKFQCSNDTYVRYVINDAVVPIETCSTGPGFSCEIND
FYGYAEKRVAGTDFLKVCNVSSVSNSTELTFFWDWNTKHYNDTLLKQ
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgttgaagtcagccgtttattcaattttagccgcttctttggttaatgcaggtaccata
cccctcggaaagttatctgacattgacaaaatcggaactcaaacggaaattttcccattt
ttgggtggttctgggccatactactctttccctggtgattatggtatttctcgtgatttg
ccggaaagttgtgaaatgaagcaagtgcaaatggttggtagacacggtgaaagatacccc
actgtcagcaaagccaaaagtatcatgacaacgtggtacaaattgagtaactataccggt
caattcagcggagcattgtctttcttgaacgatgactacgaatttttcattcgtgacacc
aaaaacctagaaatggaaaccacacttgccaattcggtcaatgttttgaacccatatacc
ggtgagatgaatgctaagagacacgctcgtgatttcttggcgcaatatggctacatggtc
gaaaaccaaaccagttttgccgtttttacgtctaactcgaacagatgtcatgatactgcc
cagtatttcattgacggtttgggtgataaattcaacatatccttgcaaaccatcagtgaa
gccgagtctgctggtgccaatactctgagtgcccaccattcgtgtcctgcttgggacgat
gatgtcaacgatgacattttgaaaaaatatgataccaaatatttgagtggtattgccaag
agattaaacaaggaaaacaagggtttgaatctgacttcaagtgatgcaaacacttttttt
gcatggtgtgcatatgaaataaacgctagaggttacagtgacatctgtaacatcttcacc
aaagatgaattggtccgtttctcctacggccaagacttggaaacttattatcaaacggga
ccaggctatgacgtcgtcagatccgtcggtgccaacttgttcaacgcttcagtgaaacta
ctaaaggaaagtgaggtccaggaccaaaaggtttggttgagtttcacccacgataccgat
attctgaactatttgaccactatcggcataatcgatgaccaaaataacttgaccgccgaa
catgttccattcatggaaaacactttccacagatcctggtacgttccacaaggtgctcgt
gtttacactgaaaagttccagtgttccaatgacacctatgttagatacgtcatcaacgat
gctgtcgttccaattgaaacctgttctactggtccagggttctcttgtgaaataaatgac
ttctacggctatgctgaaaagagagtagccggtactgacttcctaaaggtctgtaacgtc
agcagcgtcagtaactctactgaattgacctttttctgggactggaataccaagcactac
aacgacactttattaaaacagtaa

DBGET integrated database retrieval system