KEGG   Saccharomyces cerevisiae (budding yeast): YBL019W
Entry
YBL019W           CDS       T00005                                 
Symbol
APN2, ETH1
Name
(RefSeq) DNA-(apurinic or apyrimidinic site) lyase APN2
  KO
K10772  AP endonuclease 2 [EC:4.2.99.18]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    YBL019W (APN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YBL019W (APN2)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     YBL019W (APN2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     YBL019W (APN2)
SSDB
Motif
Pfam: Exo_endo_phos zf-GRF Exo_endo_phos_2
Other DBs
NCBI-GeneID: 852262
NCBI-ProteinID: NP_009534
SGD: S000000115
UniProt: P38207
LinkDB
Position
II:184353..185915
AA seq 520 aa
MSSSENTLLDGKSENTIRFLTFNVNGIRTFFHYQPFSQMNQSLRSVFDFFRADIITFQEL
KTEKLSISKWGRVDGFYSFISIPQTRKGYSGVGCWIRIPEKNHPLYHALQVVKAEEGITG
YLTIKNGKHSAISYRNDVNQGIGGYDSLDPDLDEKSALELDSEGRCVMVELACGIVIISV
YCPANSNSSEEGEMFRLRFLKVLLRRVRNLDKIGKKIVLMGDVNVCRDLIDSADTLEQFS
IPITDPMGGTKLEAQYRDKAIQFIINPDTPHRRIFNQILADSLLPDASKRGILIDTTRLI
QTRNRLKMYTVWNMLKNLRPSNYGSRIDFILVSLKLERCIKAADILPDILGSDHCPVYSD
LDILDDRIEPGTTQVPIPKFEARYKYNLRNHNVLEMFAKKDTNKESNKQKYCVSKVMNTK
KNSNIKNKSLDSFFQKVNGEKDDRIKESSEIPQQAKKRISTPKLNFKDVFGKPPLCRHGE
ESMLKTSKTSANPGRKFWICKRSRGDSNNTESSCGFFQWV
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgtcatcaagcgaaaacacgttactggatggaaagtcagagaacacaatacgattttta
actttcaatgtcaatggtataagaaccttttttcattatcaaccattttctcaaatgaat
caatcccttagatctgttttcgacttttttcgagcagacataataacattccaagagctc
aagacggaaaaattgtctatctctaagtgggggagagttgatggtttttattcttttatt
tctatccctcaaaccagaaagggatattctggcgttggctgctggattagaattccggaa
aagaaccacccactataccatgcattacaagtcgttaaggcagaagaaggtataacgggt
tacttgacaataaaaaatggtaagcattcagcaatctcctatagaaacgacgtaaatcaa
ggaattggtggttacgattctttagatcccgatttagatgagaaaagtgcactggaacta
gattcagaaggcagatgtgttatggttgaactggcatgtggaatagttattatcagtgta
tattgtcccgcaaattcgaactcatcggaggagggtgagatgtttagattaaggttcttg
aaagttttattaagaagagttcggaatttggacaaaattgggaagaagattgtgctaatg
ggcgacgtaaatgtttgccgggatcttatagacagtgccgatacattagaacaattctca
attccaataacagatcccatgggtggaacaaagttagaagcacaatatagggataaagca
atccaatttattatcaatccggacacgccacatcggaggatatttaatcaaatattggct
gattcacttttaccagacgcgagtaaaagggggatactgatagacactacgaggctaatt
caaacaagaaatcgacttaaaatgtatacagtctggaatatgttaaaaaatttaagacct
tcgaattatggctcacggatagattttatcctagtgtccttaaagcttgaacgatgcata
aaagcagctgacattcttccggatatattgggctctgaccattgtcctgtgtattctgat
ttagatatactggacgacagaattgaacctggtacgacacaagttcccataccaaaattc
gaagcaaggtacaaatataatttaagaaaccataatgttttagagatgtttgccaaaaag
gatacgaataaagaatctaataaacaaaaatattgtgtatcaaaagtcatgaataccaaa
aaaaacagcaacatcaaaaacaaatcgctcgactcatttttccagaaggtaaatggagaa
aaagatgacaggattaaagaatcctctgaaattccacagcaagctaaaaaaagaatctcc
acgccaaagttgaatttcaaggatgtctttggaaagcctcccctgtgcaggcatggggag
gaatccatgctgaaaacatcgaaaacttcggccaatccaggtagaaagttctggatttgc
aagagatctcggggtgattcaaataatacagaatcatcttgtgggttttttcagtgggtt
taa

DBGET integrated database retrieval system