KEGG   Saccharomyces cerevisiae (budding yeast): YBR087W
Entry
YBR087W           CDS       T00005                                 
Symbol
RFC5
Name
(RefSeq) replication factor C subunit 5
  KO
K10756  replication factor C subunit 3/5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YBR087W (RFC5)
   03420 Nucleotide excision repair
    YBR087W (RFC5)
   03430 Mismatch repair
    YBR087W (RFC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YBR087W (RFC5)
   03036 Chromosome and associated proteins [BR:sce03036]
    YBR087W (RFC5)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YBR087W (RFC5)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    YBR087W (RFC5)
  DNA Replication Termination Factors
   ELG1-RFC complex
    YBR087W (RFC5)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    YBR087W (RFC5)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     YBR087W (RFC5)
  Check point factors
   HRAD17(Rad24)-RFC complex
    YBR087W (RFC5)
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA DNA_pol3_delta AAA_assoc_2 Rad17 Rep_fac_C AAA_16 AAA_22 RuvB_N AAA_5
Other DBs
NCBI-GeneID: 852383
NCBI-ProteinID: NP_009644
SGD: S000000291
UniProt: P38251
Structure
LinkDB
Position
II:423765..424829
AA seq 354 aa
MSLWVDKYRPKSLNALSHNEELTNFLKSLSDQPRDLPHLLLYGPNGTGKKTRCMALLESI
FGPGVYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSDMGNNDRIVIQELLKEVAQME
QVDFQDSKDGLAHRYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSMSPIIAP
IKSRCLLIRCPAPSDSEISTILSDVVTNERIQLETKDILKRIAQASNGNLRVSLLMLESM
ALNNELALKSSSPIIKPDWIIVIHKLTRKIVKERSVNSLIECRAVLYDLLAHCIPANIIL
KELTFSLLDVETLNTTNKSSIIEYSSVFDERLSLGNKAIFHLEGFIAKVMCCLD
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtcattgtgggtagataaatacagacctaagtccttgaatgctctttcacataatgaa
gagttgacaaattttctaaaatcgttatctgatcagcctcgtgatttacctcatctttta
ctgtatggaccaaatggtacaggtaagaaaacgcgttgtatggcattattggagtccata
tttggacctggagtctatagattgaaaattgatgtcagacaatttgtcactgcttcgaac
agaaaactagaactgaatgtggtcagctcgccataccatttagagatcacgccaagtgat
atgggtaacaatgatagaattgtcatccaagaactattgaaagaagtggctcaaatggaa
caagtggactttcaagattctaaggatggacttgcccatagatataagtgtgttattatc
aacgaggcgaactcgttaacaaaagatgctcaagctgctttaagacgtaccatggaaaaa
tactccaaaaacattaggttgataatggtctgcgattcgatgtcgcctataattgctcct
atcaaatcccgttgtctgttgattcgttgtcctgcaccaagcgatagcgaaatttcaact
atcttgtctgatgtggtgacaaatgaaagaatacaactagaaacaaaggatattttaaaa
agaattgctcaggcatcgaatggaaacttgcgagtctccctattaatgcttgaatctatg
gcactgaacaacgaattagcattgaaaagcagtagccctataataaaaccagattggatt
atagtgatccataaattaacgaggaaaatcgttaaagagagatctgtcaattctttaatc
gaatgcagagctgtcctatacgatttactagctcattgtatacctgccaatatcatctta
aaggaactaacgttttctttgttggatgtggaaaccctgaataccacgaataaatcgtcc
ataattgaatactcaagtgtttttgacgaaagattatcacttggaaacaaagcaatattc
catttggaagggttcatagcaaaagttatgtgctgtctagattaa

KEGG   Saccharomyces cerevisiae (budding yeast): YJR068W
Entry
YJR068W           CDS       T00005                                 
Symbol
RFC2
Name
(RefSeq) replication factor C subunit 2
  KO
K10755  replication factor C subunit 2/4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YJR068W (RFC2)
   03420 Nucleotide excision repair
    YJR068W (RFC2)
   03430 Mismatch repair
    YJR068W (RFC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YJR068W (RFC2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YJR068W (RFC2)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YJR068W (RFC2)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    YJR068W (RFC2)
  DNA Replication Termination Factors
   ELG1-RFC complex
    YJR068W (RFC2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    YJR068W (RFC2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     YJR068W (RFC2)
  Check point factors
   HRAD17(Rad24)-RFC complex
    YJR068W (RFC2)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 RuvB_N AAA_11 AAA_22 AAA_assoc_2 AAA_14 AAA_16 Mg_chelatase AAA_19 ResIII AAA_7 DUF815 AAA_24 AAA_23 AAA_30 DNA_pol3_gamma3 AAA_5 TIP49 DUF2075 AAA_3 AAA_18 AAA_28
Other DBs
NCBI-GeneID: 853531
NCBI-ProteinID: NP_012602
SGD: S000003829
UniProt: P40348
Structure
LinkDB
Position
X:567643..568704
AA seq 353 aa
MFEGFGPNKKRKISKLAAEQSLAQQPWVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPH
MLFYGPPGTGKTSTILALTKELYGPDLMKSRILELNASDERGISIVREKVKNFARLTVSK
PSKHDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPL
ASRCSKFRFKALDASNAIDRLRFISEQENVKCDDGVLERILDISAGDLRRGITLLQSASK
GAQYLGDGKNITSTQVEELAGVVPHDILIEIVEKVKSGDFDEIKKYVNTFMKSGWSAASV
VNQLHEYYITNDNFDTNFKNQISWLLFTTDSRLNNGTNEHIQLLNLLVKISQL
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgtttgaagggtttggtccaaataaaaagcgtaagatatcaaagttagccgcagagcaa
tcattggcacaacaaccctgggttgagaaatacaggcccaaaaacctagatgaagtgaca
gctcaagatcatgccgttactgttttgaagaaaaccttaaagtcagctaatctaccacat
atgttgttttatggtcccccaggaactggtaaaacgtctaccattttagcgctaacaaaa
gaattatatggacccgacttgatgaaatcaagaatattggagttgaacgcttctgacgaa
cgtggtatctctattgtaagagaaaaggtaaaaaattttgcaagattgactgtatccaag
cctagcaaacatgacttggagaactatccgtgcccaccgtataagatcattattctcgat
gaggccgattcaatgactgccgatgcacagagtgcattacgtagaacaatggaaacctat
tcaggagtaacaagattctgtttgatttgtaattatgtgacaagaattattgacccgcta
gcgtcccgttgttccaaatttagattcaaagccctagacgcaagtaatgccattgaccgt
ttgaggtttatcagcgaacaagaaaatgttaaatgtgatgatggagttttggaaaggatc
ttggacatttcggcaggtgacttgagaagaggcattacattattacaatccgcttccaag
ggggcgcaatacttgggtgatggtaaaaacataacttctacccaagtggaagaattagct
ggtgtggtacctcatgacattctaatagaaattgttgaaaaagtcaaaagtggtgatttt
gatgagattaagaaatacgtcaatacgtttatgaaaagcggttggtctgctgcgtcagta
gttaaccaactacatgaatattacatcaccaacgataactttgatacgaacttcaaaaat
caaatatcttggttgctgtttactacggattccagattaaacaacggaacgaacgagcac
atccaattattaaacttattggttaaaatatcccaactctaa

KEGG   Saccharomyces cerevisiae (budding yeast): YNL290W
Entry
YNL290W           CDS       T00005                                 
Symbol
RFC3
Name
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YNL290W (RFC3)
   03420 Nucleotide excision repair
    YNL290W (RFC3)
   03430 Mismatch repair
    YNL290W (RFC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YNL290W (RFC3)
   03036 Chromosome and associated proteins [BR:sce03036]
    YNL290W (RFC3)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YNL290W (RFC3)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    YNL290W (RFC3)
  DNA Replication Termination Factors
   ELG1-RFC complex
    YNL290W (RFC3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    YNL290W (RFC3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     YNL290W (RFC3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    YNL290W (RFC3)
SSDB
Motif
Pfam: AAA DNA_pol3_delta2 Rep_fac_C Rad17 DNA_pol3_delta AAA_assoc_2 RuvB_N AAA_16 AAA_14 AAA_22 AAA_11 ResIII DUF815 AAA_7 AAA_24 AAA_5 AAA_30 AAA_19 DEAD bpMoxR AAA_18 Viral_helicase1 AAA_3 Mg_chelatase DUF6323 TIP49 AAA_25 RNA_helicase DUF2075 AAA_28 IstB_IS21 Methyltransf_31 AAA_33
Other DBs
NCBI-GeneID: 855426
NCBI-ProteinID: NP_014109
SGD: S000005234
UniProt: P38629
Structure
LinkDB
Position
XIV:86218..87240
AA seq 340 aa
MSTSTEKRSKENLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKT
STIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEAD
AMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRIAN
VLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPR
PSDLKAVLKSILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLL
TKLADIEYSISKGGNDQIQGSAVIGAIKASFENETVKANV
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcgacaagtacagagaagaggagcaaagaaaaccttccatgggttgaaaaatacaga
cccgaaacgttggacgaagtgtacggacaaaatgaggtgatcaccacagttcgtaaattt
gtagatgaaggtaaattgccacatcttctattctatgggcctccaggtaccggtaaaact
tctacaattgttgctttggcacgtgagatatatggtaagaattactcgaacatggttttg
gagctgaatgcatccgatgacagaggtattgatgtggtgaggaatcaaattaaagacttt
gcctctacaagacaaatcttctctaaagggttcaagttaattatactggatgaagcagat
gccatgaccaatgccgcacaaaatgcgttgagaagagttatagaacggtacaccaagaat
acgcggttctgtgtattggccaattatgcgcataaacttacacctgcgttattgagtagg
tgcacgagattcagatttcagcccttgccccaagaggccattgagcgtcggatagccaac
gtcttggtgcatgagaagctgaagttgtctcctaatgcggagaaggccttaatagaactt
tctaatggggatatgagacgtgtgttaaacgttttgcagtcttgcaaagctactttagac
aatcccgacgaggatgagatcagtgacgacgttatctatgaatgctgtggggcacccaga
ccaagtgacttaaaggcagtattgaagtcgatactggaggacgattggggtaccgcccac
tacacacttaataaggtacgcagtgccaagggtctcgcgttgatcgacctaatcgagggc
atagtgaagatactggaagactacgaacttcaaaatgaggaaacaagagtgcatttgctt
accaaactggccgatatagagtactcgatatccaagggtggcaacgaccagattcagggc
agcgcggtcattggcgccatcaaggccagcttcgagaacgaaactgttaaagccaacgta
taa

KEGG   Saccharomyces cerevisiae (budding yeast): YOL094C
Entry
YOL094C           CDS       T00005                                 
Symbol
RFC4
Name
(RefSeq) replication factor C subunit 4
  KO
K10755  replication factor C subunit 2/4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YOL094C (RFC4)
   03420 Nucleotide excision repair
    YOL094C (RFC4)
   03430 Mismatch repair
    YOL094C (RFC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YOL094C (RFC4)
   03036 Chromosome and associated proteins [BR:sce03036]
    YOL094C (RFC4)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YOL094C (RFC4)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    YOL094C (RFC4)
  DNA Replication Termination Factors
   ELG1-RFC complex
    YOL094C (RFC4)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    YOL094C (RFC4)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     YOL094C (RFC4)
  Check point factors
   HRAD17(Rad24)-RFC complex
    YOL094C (RFC4)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_16 Rad17 AAA_14 AAA_22 RuvB_N Viral_helicase1 AAA_3 TniB Mg_chelatase AAA_assoc_2 NTPase_1 MeaB DNA_pol3_delta AAA_19 NB-ARC FtsK_SpoIIIE AAA_11 KTI12 AAA_24 bpMoxR RNA_helicase
Other DBs
NCBI-GeneID: 854059
NCBI-ProteinID: NP_014547
SGD: S000005454
UniProt: P40339
Structure
LinkDB
Position
XV:complement(141584..142555)
AA seq 323 aa
MSKTLSLQLPWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVH
CLAHELLGRSYADGVLELNASDDRGIDVVRNQIKHFAQKKLHLPPGKHKIVILDEADSMT
AGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSRCAILRYSKLSDEDVLKRLLQIIK
LEDVKYTNDGLEAIIFTAEGDMRQAINNLQSTVAGHGLVNADNVFKIVDSPHPLIVKKML
LASNLEDSIQILRTDLWKKGYSSIDIVTTSFRVTKNLAQVKESVRLEMIKEIGLTHMRIL
EGVGTYLQLASMLAKIHKLNNKA
NT seq 972 nt   +upstreamnt  +downstreamnt
atgtccaaaactttatctttgcaacttccatgggttgagaaataccgtccccaagtttta
tctgatatagtcggtaataaagagaccattgatagacttcagcaaatcgctaaagatggt
aacatgccccatatgatcatatcaggtatgccaggtataggtaagaccacttcggtacat
tgccttgctcacgagctccttggccgctcttatgctgacggtgttttagagttgaacgct
tcagatgacagaggtattgatgtcgtcagaaaccaaataaaacattttgcccagaagaaa
ctacatttgcctccagggaaacataaaatcgttattcttgatgaggcggattccatgact
gctggtgctcagcaagcgttgagaaggaccatggagctatattcgaactctacaaggttt
gcatttgcttgtaatcaatcaaacaagatcattgagccgctgcaaagtagatgtgcgatt
ttgaggtattctaaactatccgatgaagacgttctaaaacgtcttttacaaatcataaag
ctagaggatgttaagtatacaaatgatgggttagaagcaatcatttttacagcggagggt
gacatgagacaggccataaacaatctacaaagtacagtagcaggacacggtttagtgaac
gcagacaatgtcttcaaaattgttgattctcctcaccctctaatagtgaagaaaatgtta
ctagcctccaacctagaagattcaattcaaatcttaagaacagatctttggaaaaagggt
tattcctcgattgatatcgtcacaacatctttccgcgttaccaaaaacttagcacaagtg
aaagaatcagtaagattggaaatgataaaagaaatcggtttgacccatatgagaattctg
gagggtgttggaacgtacttgcaactggctagtatgttagcgaaaattcataaactaaat
aataaagcctga

KEGG   Saccharomyces cerevisiae (budding yeast): YOR217W
Entry
YOR217W           CDS       T00005                                 
Symbol
RFC1, CDC44
Name
(RefSeq) replication factor C subunit 1
  KO
K10754  replication factor C subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YOR217W (RFC1)
   03420 Nucleotide excision repair
    YOR217W (RFC1)
   03430 Mismatch repair
    YOR217W (RFC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YOR217W (RFC1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YOR217W (RFC1)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    YOR217W (RFC1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     YOR217W (RFC1)
SSDB
Motif
Pfam: RFC1 AAA BRCT RuvB_N Rad17 AAA_22 AAA_16 AAA_33 AAA_assoc_2 AAA_17 AAA_18 RNA_helicase AAA_14 AAA_24 AAA_5 NACHT NTPase_1 Ilar_coat
Other DBs
NCBI-GeneID: 854392
NCBI-ProteinID: NP_014860
SGD: S000005743
UniProt: P38630
Structure
LinkDB
Position
XV:749301..751886
AA seq 861 aa
MVNISDFFGKNKKSVRSSTSRPTRQVGSSKPEVIDLDTESDQESTNKTPKKMPVSNVIDV
SETPEGEKKLPLPAKRKASSPTVKPASSKKTKPSSKSSDSASNITAQDVLDKIPSLDLSN
VHVKENAKFDFKSANSNADPDEIVSEIGSFPEGKPNCLLGLTIVFTGVLPTLERGASEAL
AKRYGARVTKSISSKTSVVVLGDEAGPKKLEKIKQLKIKAIDEEGFKQLIAGMPAEGGDG
EAAEKARRKLEEQHNIATKEAELLVKKEEERSKKLAATRVSGGHLERDNVVREEDKLWTV
KYAPTNLQQVCGNKGSVMKLKNWLANWENSKKNSFKHAGKDGSGVFRAAMLYGPPGIGKT
TAAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHNEEAQNLNGKHFV
IIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDA
NSIKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQVINLLSTISTTTKTINHENINEIS
KAWEKNIALKPFDIAHKMLDGQIYSDIGSRNFTLNDKIALYFDDFDFTPLMIQENYLSTR
PSVLKPGQSHLEAVAEAANCISLGDIVEKKIRSSEQLWSLLPLHAVLSSVYPASKVAGHM
AGRINFTAWLGQNSKSAKYYRLLQEIHYHTRLGTSTDKIGLRLDYLPTFRKRLLDPFLKQ
GADAISSVIEVMDDYYLTKEDWDSIMEFFVGPDVTTAIIKKIPATVKSGFTRKYNSMTHP
VAIYRTGSTIGGGGVGTSTSTPDFEDVVDADDNPVPADDEETQDSSTDLKKDKLIKQKAK
PTKRKTATSKPGGSKKRKTKA
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggtcaatatttctgatttctttggtaaaaataagaaatccgtaagatcgtcaacatcc
agacctacgagacaggtgggttcgtctaaaccagaagttatcgacttagatactgaatct
gaccaagaatcaaccaataaaacaccaaagaagatgcctgtaagtaatgtaattgatgta
tcagagacacctgaaggagaaaaaaagctacctcttcccgctaagaggaaggcctcttca
ccaactgtaaagccagcaagttcaaaaaaaaccaaaccctcctctaaaagttcagactcg
gcttcgaatattacggctcaagatgtactagataagattccatccttggatctgtcaaat
gttcatgtgaaagagaatgctaaatttgatttcaaaagcgcaaattcaaatgcggatcca
gatgaaattgtttctgaaataggtagttttccagaaggaaagccaaattgtttattaggt
ctaacaattgtcttcacaggtgttctgccaaccttggagcgtggtgcatcggaagcttta
gcgaaaagatacggagcaagggttactaaatcaatttcaagcaaaacttctgtagtagtc
ttaggtgatgaagcagggccaaagaaactagaaaaaatcaagcaattgaaaatcaaagcc
atagacgaagaaggctttaagcaattaattgctgggatgcctgctgaaggtggtgacggg
gaagctgccgaaaaagcacgtcgaaaattagaagaacagcataatattgctaccaaagaa
gcagaattgcttgttaagaaagaagaggaaaggtcgaagaagcttgcagccactagagtt
tctggtggccatctggagagagacaatgtggttagggaagaagataaattgtggacagta
aagtacgcaccaacgaatctacaacaggtctgtggtaacaaaggaagtgtaatgaaatta
aaaaactggttggctaattgggaaaattcaaagaaaaatagttttaaacatgctggtaaa
gatggctctggtgttttcagggctgcaatgttatacggtcctcctggtattgggaagaca
actgctgctcatttagttgcacaagagcttgggtatgacattcttgaacaaaacgcttct
gatgttcgctctaaaactttacttaatgccggtgttaaaaacgctcttgataacatgtct
gtagtgggatatttcaaacacaacgaagaagctcaaaatttgaacgggaaacattttgtc
attatcatggatgaagttgatggtatgagcggaggcgatagggggggagttggccagctg
gcacagttttgtcgtaagacgtcaactccattgattctaatttgtaatgaacgtaattta
ccaaaaatgagaccattcgatagagtatgtcttgatatccaatttagaagacctgatgct
aacagtatcaaatcaagattaatgacaattgcgatcagagaaaagttcaaacttgatcca
aatgtcattgataggttgatacagactacaagaggtgatatccgccaggttattaatcta
ctttcaacgatatctacgactactaaaaccataaaccatgaaaatatcaacgagatctca
aaggcatgggaaaagaatattgccctaaaaccctttgacattgcccataaaatgttggat
ggacaaatatactcagacataggttcaaggaactttacactgaatgataagatcgcatta
tattttgatgactttgatttcacacccctaatgattcaggaaaactatttatctacaaga
ccaagcgttttgaaacccggccagtcacatttggaagcagttgctgaggcggctaactgt
atttcattaggtgatattgtcgaaaagaagattcgtagtagtgagcaattatggagtctt
ttgcctttgcatgctgttctttcatctgtttatccagcatcaaaagttgccggccatatg
gcgggaagaatcaatttcacagcttggttgggccaaaattctaaatctgccaaatattat
aggttactgcaagagatacattatcatacaagactaggtacatctactgataaaattgga
ctaaggctggattacctaccaacttttagaaaaagattattggacccatttttgaagcaa
ggtgctgatgcaatttcatctgtcatagaggtaatggacgattactatttgaccaaagaa
gactgggattctattatggagtttttcgtaggtcctgatgtgaccacagccattatcaaa
aagataccagctacggttaaaagtggattcacgcggaaatacaacagtatgacacatcca
gtcgcaatttacagaacaggtagtactattggtggtggtggtgttggcaccagtactagc
acccccgatttcgaagatgtcgttgacgcagatgacaatccagttcccgcagatgatgaa
gaaacacaagatagtagcacagacttgaagaaggataaacttatcaagcagaaagccaaa
cctacgaagaggaagactgccaccagtaaacctggtggtagcaaaaaaaggaaaacgaaa
gcatga

DBGET integrated database retrieval system