KEGG   Saccharomyces cerevisiae (budding yeast): YBR088C
Entry
YBR088C           CDS       T00005                                 
Symbol
POL30
Name
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YBR088C (POL30)
   03410 Base excision repair
    YBR088C (POL30)
   03420 Nucleotide excision repair
    YBR088C (POL30)
   03430 Mismatch repair
    YBR088C (POL30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YBR088C (POL30)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YBR088C (POL30)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    YBR088C (POL30)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     YBR088C (POL30)
   MMR (mismatch excision repair)
    Other MMR factors
     YBR088C (POL30)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    YBR088C (POL30)
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Histone
Other DBs
NCBI-GeneID: 852385
NCBI-ProteinID: NP_009645
SGD: S000000292
UniProt: P15873
Structure
LinkDB
Position
II:complement(424990..425766)
AA seq 258 aa
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEY
RCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMD
IDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSV
IIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFD
LKSGFLQFFLAPKFNDEE
NT seq 777 nt   +upstreamnt  +downstreamnt
atgttagaagcaaaatttgaagaagcatcccttttcaagagaataattgatggtttcaaa
gattgtgtccagttggtcaatttccaatgtaaagaagatggtatcattgcacaagctgtc
gatgactcaagagttctattggtctccttggaaataggtgtcgaagccttccaagaatat
agatgtgaccatcctgttacgttaggtatggatctaacctcactaagtaaaatcctacgt
tgtggtaacaacaccgatacattaacactaattgctgacaacacaccggattccatcatc
ttattatttgaggataccaagaaagaccgtatagccgaatactctctgaaattgatggat
atcgatgctgatttcttaaagattgaagaattacagtacgactccaccctgtcattgcca
tcttccgaattctctaaaattgttcgtgacttgtcccaattgagtgattctattaatatc
atgatcaccaaagaaacaataaagtttgtagctgacggtgatatcggatcaggttcagtc
ataataaaaccattcgtggatatggaacatcctgaaacaagcatcaaacttgaaatggat
caacctgtcgacttgacgttcggagctaaatatttattggacatcattaagggctcctcc
ctttctgatagagttggtatcaggctctccagcgaagctcctgctttattccaatttgat
ttgaagagtgggttcctacagtttttcttggctcctaaatttaatgacgaagaataa

DBGET integrated database retrieval system