KEGG   Saccharomyces cerevisiae (budding yeast): YBR112C
Entry
YBR112C           CDS       T00005                                 
Symbol
CYC8, CRT8, SSN6
Name
(RefSeq) transcription regulator CYC8
  KO
K06665  general transcriptional corepressor CYC8
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YBR112C (CYC8)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBR112C (CYC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YBR112C (CYC8)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     YBR112C (CYC8)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_17 TPR_8 TPR_11 TPR_7 TPR_14 TPR_12 TPR_16 TPR_9 TPR_19 PPTA TPR_10 TPR_6
Other DBs
NCBI-GeneID: 852410
NCBI-ProteinID: NP_009670
SGD: S000000316
UniProt: P14922
LinkDB
Position
II:complement(462870..465770)
AA seq 966 aa
MNPGGEQTIMEQPAQQQQQQQQQQQQQQQQAAVPQQPLDPLTQSTAETWLSIASLAETLG
DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL
GHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELD
PHFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWFQLGSVLESMGEW
QGAKEAYEHVLAQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWY
HLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN
PYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALTKQLENPGNINK
SNGAPTNASPAPPPVILQPTLQPNDQGNPLNTRISAQSANATASMVQQQHPAQQTPINSS
ATMYSNGASPQLQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAHAQA
QAQAQAQAQAQAQAQAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQPLPRQQLQQKG
VSVQMLNPQQGQPYITQPTVIQAHQLQPFSTQAMEHPQSSQLPPQQQQLQSVQHPQQLQG
QPQAQAPQPLIQHNVEQNVLPQKRYMEGAIHTLVDAAVSSSTHTENNTKSPRQPTHAIPT
QAPATGITNAEPQVKKQKLNSPNSNINKLVNTATSIEENAKSEVSNQSPAVVESNTNNTS
QEEKPVKANSIPSVIGAQEPPQEASPAEEATKAASVSPSTKPLNTEPESSSVQPTVSSES
STTKANDQSTAETIELSTATVPAEASPVEDEVRQHSKEENGTTEASAPSTEEAEPAASRD
AEKQQDETAATTITVIKPTLETMETVKEEAKMREEEQTSQEKSPQENTLPRENVVRQVEE
DENYDD
NT seq 2901 nt   +upstreamnt  +downstreamnt
atgaatccgggcggtgaacaaacaataatggaacaacccgctcaacagcaacaacaacag
caacaacaacagcagcaacagcaacagcaggcagcagttcctcagcagccactcgaccca
ttaacacaatcaactgcggaaacttggctctccattgcttctttggcagaaacccttggt
gatggcgacagggccgcaatggcatatgacgccactttacagttcaatccctcatctgca
aaggctttaacatctttggctcacttgtaccgttccagagacatgttccaaagagctgca
gaattatatgaaagagcacttttggtaaatcccgaactatcagatgtgtgggctacttta
ggtcattgttatctgatgctggatgatctgcaaagagcttacaatgcctatcaacaggct
ctctaccacctcagtaatcccaacgtaccgaaattatggcatggaatcggcattctttat
gacagatatggttcgctcgactatgccgaagaagcttttgccaaagttttggaattggac
cctcattttgaaaaggcaaacgaaatttacttcagactaggtattatttataaacatcag
ggtaaatggtctcaagctttggaatgcttcagatacattctccctcaacctcctgctccc
ttgcaggagtgggacatatggtttcagttgggtagtgttttggagagtatgggagagtgg
caaggtgcgaaggaagcctacgagcatgtcttggctcaaaatcaacatcatgccaaagta
ttacaacaattaggttgtctttacggtatgagtaacgtacaattttatgaccctcaaaag
gcattggattatcttctaaagtcgttagaagcagatccctccgatgccactacatggtac
catctcggtagagtgcatatgattagaacagattatactgccgcatatgatgctttccaa
caagctgttaatagagattcaagaaaccctatcttttggtgctcaatcggtgttttatat
taccaaatttctcaatacagagacgccttagacgcgtacacaagagccataagattaaat
ccttatattagtgaagtttggtacgatctaggtactctttacgaaacttgtaacaaccaa
ttatctgacgcccttgatgcgtataagcaagctgcaagactggacgtaaataatgttcac
ataagagaaagattagaagctttaacaaagcagttagaaaacccaggcaatataaacaaa
tcgaacggtgcgccaacgaatgcctctcctgccccacctcctgtgattttacaacctacc
ttacaacctaatgatcaaggaaatcctttgaacactagaatttcagcccaatctgccaat
gctactgcttcaatggtacaacaacagcatcctgctcaacaaacgcctattaactcttct
gcaacaatgtacagtaatggagcttcccctcaattacaagctcaagctcaagctcaagct
caagcacaagctcaagcacaagcacaagctcaagcacaagcacaagcacaagcgcaagca
caagcacaagcacaggcgcaagcacaggcacaagcacaagcacaagcacatgcacaagcg
caagcacaagcacaagcacaggcacaagcacaagcacaggcgcaggcacaacaacaacaa
caacaacagcaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaa
caacaacaacagcagcagcaattacagcccctaccaagacaacagctgcagcaaaaggga
gtttctgtgcaaatgttaaatcctcaacaagggcaaccatatatcacacagccaacagtc
atacaagctcaccaactgcaaccattttctacacaagctatggaacatccgcaaagctct
caactgccacctcaacagcaacaactacaatctgttcaacatccacaacaacttcaaggc
cagcctcaagcccaagctccccaacctttaatccagcataacgtggaacagaacgtttta
cctcaaaagagatacatggaaggtgcaatccacactttagtagatgccgccgtatccagt
agcacccacacagagaataacacaaagtctcctcgtcaaccaacccatgccattccaacg
caagctcccgcaacaggaataacgaacgctgaaccacaggtaaagaagcaaaagttgaac
tctccaaattcaaacatcaacaaattagtaaatactgctacttccattgaagaaaatgca
aaatctgaggtgagcaaccaatcgccagcagtagtggagtctaataccaataatacttca
caagaagaaaaacctgtaaaagcaaactcaataccttcagtaattggcgcacaggaacct
ccacaggaagctagtcctgctgaagaagctaccaaagcagcttctgtttctccttctaca
aaaccgcttaatacggaaccagagtcatctagtgtccaaccaactgtatcatcagaaagt
tcaacaacaaaagcaaatgaccaaagcactgctgagaccatagaactttctactgctact
gttcctgcagaagcaagccctgtagaagacgaagtaagacagcattctaaagaggaaaac
ggcacaactgaagcatctgcaccttctactgaagaggcggagccagcagcttccagagat
gctgaaaaacaacaagatgaaaccgctgctacaacgataactgtaatcaaacctactttg
gaaacaatggaaacagtgaaagaggaggccaaaatgcgtgaggaagagcaaacatctcaa
gaaaaatccccacaggagaacacacttccaagagaaaatgtagtaaggcaagtggaagaa
gatgaaaactacgacgactaa

DBGET integrated database retrieval system