KEGG   Saccharomyces cerevisiae (budding yeast): YBR135W
Entry
YBR135W           CDS       T00005                                 
Symbol
CKS1
Name
(RefSeq) cyclin-dependent protein kinase regulatory subunit CKS1
  KO
K02219  cyclin-dependent kinase regulatory subunit CKS1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBR135W (CKS1)
SSDB
Motif
Pfam: CKS SUIM_assoc
Other DBs
NCBI-GeneID: 852432
NCBI-ProteinID: NP_009693
SGD: S000000339
UniProt: P20486
Structure
LinkDB
Position
II:504854..505306
AA seq 150 aa
MYHHYHAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFN
SEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAATAAAQQQ
QQQQQQQQQQQQQHQTQSISNDMQVPPQIS
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtaccatcactatcacgccttccaaggcagaaagcttactgaccaagaaagagcacgc
gtgttggagtttcaagattccattcactattctccgcggtactcagacgataactatgag
tacaggcatgtgatgttacctaaggccatgctaaaagttatcccatctgattacttcaat
tcggaagtggggaccctgcgtatattaacagaagacgaatggagaggcctcggcatcaca
cagtctttggggtgggaacattatgaatgccatgcgccagaaccacacattttgctattc
aaaaggccgctgaactacgaggccgagctgagggcagcgaccgctgctgctcaacagcaa
cagcaacagcagcaacagcagcaacaacaacaacagcaacatcaaacacaatcgatttcg
aacgatatgcaagttccaccccaaatctcctag

DBGET integrated database retrieval system