KEGG   Saccharomyces cerevisiae (budding yeast): YCL061C
Entry
YCL061C           CDS       T00005                                 
Symbol
MRC1, YCL060C
Name
(RefSeq) chromatin-modulating protein MRC1
  KO
K11272  mediator of replication checkpoint protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YCL061C (MRC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YCL061C (MRC1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Tof1-Csm3-Mrc1 checkpoint complex
    YCL061C (MRC1)
SSDB
Motif
Pfam: MRC1
Other DBs
NCBI-GeneID: 850297
NCBI-ProteinID: NP_009871
SGD: S000000566
UniProt: P25588
LinkDB
Position
III:complement(18816..22106)
AA seq 1096 aa
MDDALHALSSLTAKKRTTTYKKVAVPILDENDNTNGNGPNDIDNPPELTGNGFLFANATL
NRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVSS
SFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGRPGATQ
RIDSSGATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQNRGP
DTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHTLKIREIQSELAS
EDSKREKARNVEYKKPQKPIPTKKFFSKESFLADFDDSSSNEDDDIKLENAHPKPVQNDD
ELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITLDLDSDSDEYGDDDMD
SIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKAS
RKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNKRIRQKEKRREKLEENDFQL
NAHDSGSDSGSESSGFALSGNEIADYESSGSENDNRRESDSEKEDDEIILKQKKSHHVKH
IINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNIGEDTDKFQETNVLDTQNIEEVM
AERNTIENEVKDDVYVNEEADEAIRRQLIDKEKLQLKQKEKEHEAKIKELKKRGVTNFFE
MEAEESEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKM
INKILYDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEIGDDAKLV
KNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKP
VDQKNKKVIISEDFVQKSLSFLKSNNYEDFETDKELSRIQHGNDEAIEDLYTLKQNSSIK
SFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDK
FKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRKTEGSHRYHHDHHNKKMKMKTK
TKSNKLFESGQDSFDN
NT seq 3291 nt   +upstreamnt  +downstreamnt
atggatgatgccttgcatgctttgtcctcgttgactgcaaagaagagaactaccacctac
aaaaaagttgctgttcccatactagatgagaacgataatactaatggaaatgggcccaat
gacatagacaatccgccagagttgactgggaacgggtttttatttgccaatgccacatta
aatcgtgttaagaacagattagaaggcaagaaagcacccgaacagaatcacaataatgga
aaagataggagtgagaattcgttaccaactcaattaatctctaatctttacgatggtggt
gaagagctggagaaatccgaagttaaagataatagttacagtgagaaaaatgtctcttct
tcattcacgcagacgcaaagaatacctgtcagcatccaacaagacaaggtgtttaacgta
cctatccattccgttaatgacgggaaacccacccaattaatcaaagaagatggtctcgtc
aacgaaacttctcaagcgctgaaaacacctctcacgacaggacggccaggggctacacag
cgtatagatagcagcggtgcaacctcacaaactcagcctataaaatcaattgaaccacaa
tcccaaataattacgacttccagcaatcattctaatgctctgtcgccgaaaattcctata
attccaacggaacttattggaactagtcctttatttcagtccattcaaaatcgtggtcct
gacacccaaatggatgtaccaccacagactgcgcatgatgaggataagacacaagcaatt
ggtattccacaggctacgcatcaggaacagaaaacccaaatagatacagtcgcacaaaca
cttcaagatgaagtaccacacacattaaaaattcgggaaatacaaagcgaattggcttca
gaagattctaaaagggaaaaagctagaaatgtcgaatacaaaaaaccgcaaaagccaata
ccaaccaaaaaatttttttctaaagagtcttttcttgctgattttgacgattcgtcctca
aatgaggacgatgatataaagctggaaaatgcacatccaaaaccagtacagaatgacgat
gaactgcatgagaacaaaagtgttgaattaaatctaactgatgagacaagaataaatgag
aaaagggttccactattgagctcctatgctaataatttgaaacgggaaattgactcctcg
aaatgcataacactggacctcgacagcgacagtgacgaatatggagatgatgatatggat
agcattaaattatccaaagatgaaagcgttttgccaatctctcagttatcaaaggcgact
atattaaacctgaaggcaagactctctaaacaaaatcaaaagttgtctcaaaggccgaat
aaaagtaaagacccaaaagttgatcataatgtactattaaataccttaaggaaagctagc
aggaaacaaattctggatcatcagaaagaagtgattgaaacgaaaggtctgaagctggag
gatatggccaaagaaaaggaaatagtagagaacttgctagaacaagaaattcttagaaat
aaaagaatcagacaaaaagagaagagaagggaaaaacttgaagaaaatgactttcaattg
aacgcccatgattccggttctgactcagggtcagagtcttctggatttgcattgagtggt
aatgaaattgccgattatgaatcatctggtagtgaaaatgacaatcgtagagaatccgat
agtgaaaaggaagatgatgaaattattctaaagcaaaaaaaatcccaccacgtgaaacat
atcattaacgaatcagactctgataccgaagtcgaagccaaacccaaagagaaagctgat
gaaagtctaccgaaaaggatcgccattaatctgggccattacggtgataatatcggagag
gataccgacaaatttcaagaaaccaatgttctagatacacaaaacattgaagaggtgatg
gccgaaagaaatacaatcgaaaatgaagtcaaagatgatgtatacgtcaatgaagaagct
gatgaagcaattcgccgtcagctgattgacaaagagaaattgcaactaaaacagaaagaa
aaggagcacgaggctaagataaaagagttgaagaaaagaggtgtcacaaacttctttgaa
atggaagccgaagaatccgaggatgaatggcatggtatcggtggtgcagatggagaagga
tctgacgactatgattctgacctagaaaaaatgatcgatgattattccaagaacaatttc
aatcctcatgaaatcagagaaatgcttgccgcagaaaataaggaaatggatatcaaaatg
ataaacaaaattctttatgacattaaaaatggaggatttcgtaataaaagagcaaaaaat
agcttagagctagaactaagtgatgatgatgaagacgacgtactacaacaatatcgtctc
aaaaggagagaattgatgagaaaaaggagattagaaattggcgatgatgcaaagcttgtt
aaaaacccaaagtcgagcgcattttttgaaagtatggtggaagatattatcgaatataaa
aaccccttcggggctgaagaggaatataacctagacattacaagtacggctactgaccta
gatactcaggacaatagcattaatgtaggtgataatacgggaaataatgaacagaaacct
gtagatcaaaagaacaaaaaggttatcatatctgaagactttgtgcagaaaagcttatcc
ttcctaaaaagtaataattatgaggattttgaaacggataaggagctatcaaggatacaa
catggcaatgatgaagcaattgaagatttatataccctaaaacagaatagttcgataaag
tcattcacaaattctcaaactgattcgaccacttcaaaaacagtaaacacaataattgac
ttagaaaagcgcccagaggatgaagatgaggtggaaaatggagatacatcactagttggc
gttttcaaacatccatcaataatcaaatcctttgcgtccagaacagacataaatgataag
tttaaagaaggtaacaagacagtcaagattctaaagtcttacaagacagtggggagttca
aaagcttctatcacatatatggggaaaacgagaaaattaatagcaccaaagaggaaaact
gaagggagccaccgctaccaccatgaccatcataataaaaaaatgaaaatgaaaacgaaa
acaaaatcgaataaactttttgaaagcggacaagatagctttgataattag

DBGET integrated database retrieval system