KEGG   Saccharomyces cerevisiae (budding yeast): YCR014C
Entry
YCR014C           CDS       T00005                                 
Symbol
POL4
Name
(RefSeq) DNA-directed DNA polymerase IV
  KO
K10981  DNA polymerase IV [EC:2.7.7.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    YCR014C (POL4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YCR014C (POL4)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YCR014C (POL4)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     YCR014C (POL4)
SSDB
Motif
Pfam: DNA_pol_B_thumb HHH_8 DNA_pol_B_palm DNA_pol_lambd_f Thioredoxin_4 DUF6761
Other DBs
NCBI-GeneID: 850372
NCBI-ProteinID: NP_009940
SGD: S000000607
UniProt: P25615
LinkDB
Position
III:complement(139185..140933)
AA seq 582 aa
MSLKGKFFAFLPNPNTSSNKFFKSILEKKGATIVSSIQNCLQSSRKEVVILIEDSFVDSD
MHLTQKDIFQREAGLNDVDEFLGKIEQSGIQCVKTSCITKWVQNDKFAFQKDDLIKFQPS
IIVISDNADDGQSSTDKESEISTDVESERNDDSNNKDMIQASKPLKRLLQGDKGRASLVT
DKTKYKNNELIIGALKRLTKKYEIEGEKFRARSYRLAKQSMENCDFNVRSGEEAHTKLRN
IGPSIAKKIQVILDTGVLPGLNDSVGLEDKLKYFKNCYGIGSEIAKRWNLLNFESFCVAA
KKDPEEFVSDWTILFGWSYYDDWLCKMSRNECFTHLKKVQKALRGIDPECQVELQGSYNR
GYSKCGDIDLLFFKPFCNDTTELAKIMETLCIKLYKDGYIHCFLQLTPNLEKLFLKRIVE
RFRTAKIVGYGERKRWYSSEIIKKFFMGVKLSPRELEELKEMKNDEGTLLIEEEEEEETK
LKPIDQYMSLNAKDGNYCRRLDFFCCKWDELGAGRIHYTGSKEYNRWIRILAAQKGFKLT
QHGLFRNNILLESFNERRIFELLNLKYAEPEHRNIEWEKKTA
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgtctctaaagggtaaatttttcgcctttttacctaatcctaacacatcttccaataag
ttctttaagagtatattggagaaaaagggcgccacaattgtgtcaagtattcaaaattgt
cttcaatctagccgtaaggaagtggtcattttgattgaggactcctttgttgattctgat
atgcatttgactcagaaagatattttccaaagggaagcaggcttaaatgatgtcgatgaa
tttcttggtaagattgaacagtcaggcattcaatgtgtgaaaaccagttgcatcacaaag
tgggtccagaatgataaatttgcgtttcaaaaagatgatttgattaaatttcaaccatcc
attatcgttatatcagataacgctgatgacggacaaagttctactgataaagagagtgag
atttcaactgacgtagaaagtgaaaggaatgatgacagcaacaataaagatatgatacaa
gcttcaaaacctcttaagcgactcttacagggggataaaggaagagcttcccttgttact
gacaaaacgaagtacaaaaacaatgaattgattatcggagcgttgaaaaggttaacaaaa
aaatatgagatcgaaggtgagaaatttcgtgcaagaagttatagactggctaaacagtcg
atggaaaattgcgatttcaatgttcgttccggtgaagaagcacatactaaattaaggaat
atcgggcctagtattgccaaaaaaatacaagttatattagatacgggagttttaccaggt
ttaaatgattcagtgggattagaagacaagttgaaatacttcaaaaattgttacggcatt
gggtcggaaattgctaaacgctggaatcttctaaattttgaaagcttttgtgttgcagct
aagaaggacccagaggagtttgtatcagattggacaattttatttggttggtcatattac
gacgattggttatgcaagatgtctcggaatgaatgtttcacacatttaaagaaggttcaa
aaagcgctgcgtggcattgatcctgaatgccaagtcgaattacagggaagttataatagg
ggctattccaagtgtggtgacattgatcttttatttttcaagccgttttgtaatgacacg
accgagttggcaaaaatcatggaaacgctttgtattaagttgtacaaggatggctatatc
cattgttttttacagctaacgccaaacttggaaaagctattcttaaaaagaatagtggag
agatttcgtacagcgaagattgttgggtatggagaaagaaagaggtggtattcttctgag
ataatcaagaaatttttcatgggagtcaaattgtctccaagagaattagaagaactgaaa
gaaatgaaaaatgatgaaggcacattgttaattgaagaagaagaagaagaagaaacaaaa
ttaaaaccgattgaccaatatatgtctctgaatgccaaggatggaaattattgcagaaga
ttagactttttttgttgcaagtgggatgagcttggagcaggaagaatacactatactgga
tctaaagagtacaatagatggataagaatattggcagcgcaaaaaggcttcaagcttaca
caacacggtttatttcgaaataatatccttctcgaaagctttaacgaacgcagaattttc
gagttattaaacttaaaatacgctgaacccgaacatagaaatatcgaatgggaaaaaaaa
actgcataa

DBGET integrated database retrieval system