KEGG   Saccharomyces cerevisiae (budding yeast): YCR092C
Entry
YCR092C           CDS       T00005                                 
Symbol
MSH3
Name
(RefSeq) mismatch repair protein MSH3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    YCR092C (MSH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YCR092C (MSH3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     YCR092C (MSH3)
SSDB
Motif
Pfam: MutS_V MutS_I MutS_III MutS_II MutS_IV AAA_14 Nse4-Nse3_bdg
Other DBs
NCBI-GeneID: 850454
NCBI-ProteinID: NP_010016
SGD: S000000688
UniProt: P25336
LinkDB
Position
III:complement(276764..279820)
AA seq 1018 aa
MAGQPTISRFFKKAVKSELTHKQEQEVAVGNGAGSESICLDTDEEDNLSSVASTTVTNDS
FPLKGSVSSKNSKNSEKTSGTSTTFNDIDFAKKLDRIMKRRSDENVEAEDDEEEGEEDFV
KKKARKSPTAKLTPLDKQVKDLKMHHRDKVLVIRVGYKYKCFAEDAVTVSRILHIKLVPG
KLTIDESNPQDCNHRQFAYCSFPDVRLNVHLERLVHHNLKVAVVEQAETSAIKKHDPGAS
KSSVFERKISNVFTKATFGVNSTFVLRGKRILGDTNSIWALSRDVHQGKVAKYSLISVNL
NNGEVVYDEFEEPNLADEKLQIRIKYLQPIEVLVNTDDLPLHVAKFFKDISCPLIHKQEY
DLEDHVVQAIKVMNEKIQLSPSLIRLVSKLYSHMVEYNNEQVMLIPSIYSPFASKIHMLL
DPNSLQSLDIFTHDGGKGSLFWLLDHTRTSFGLRMLREWILKPLVDVHQIEERLDAIECI
TSEINNSIFFESLNQMLNHTPDLLRTLNRIMYGTTSRKEVYFYLKQITSFVDHFKMHQSY
LSEHFKSSDGRIGKQSPLLFRLFSELNELLSTTQLPHFLTMINVSAVMEKNSDKQVMDFF
NLNNYDCSEGIIKIQRESESVRSQLKEELAEIRKYLKRPYLNFRDEVDYLIEVKNSQIKD
LPDDWIKVNNTKMVSRFTTPRTQKLTQKLEYYKDLLIRESELQYKEFLNKITAEYTELRK
ITLNLAQYDCILSLAATSCNVNYVRPTFVNGQQAIIAKNARNPIIESLDVHYVPNDIMMS
PENGKINIITGPNMGGKSSYIRQVALLTIMAQIGSFVPAEEIRLSIFENVLTRIGAHDDI
INGDSTFKVEMLDILHILKNCNKRSLLLLDEVGRGTGTHDGIAISYALIKYFSELSDCPL
ILFTTHFPMLGEIKSPLIRNYHMDYVEEQKTGEDWMSVIFLYKLKKGLTYNSYGMNVAKL
ARLDKDIINRAFSISEELRKESINEDALKLFSSLKRILKSDNITATDKLAKLLSLDIH
NT seq 3057 nt   +upstreamnt  +downstreamnt
atggcgggacaacccacaataagcaggtttttcaagaaggcggtaaaatcagagctgacg
cataagcaagaacaagaagttgcggttggaaatggcgctggtagcgaatccatctgcctt
gacactgatgaagaggacaatttatcttctgttgcaagcacaacagtaactaatgatagc
tttccactcaaaggcagtgtttcttccaagaattcgaaaaattcagaaaagactagtggt
acttcgacaacatttaatgatattgactttgctaagaaattggataggattatgaaaaga
cgaagtgatgaaaatgttgaggctgaagatgatgaggaagagggtgaggaagatttcgta
aaaaaaaaagccagaaagtcccctacagcgaaacttactcccttggacaaacaggtgaag
gacctgaaaatgcatcatagagataaagtgcttgttattagagtaggctacaagtacaaa
tgttttgcagaggatgcagtaacggttagcagaatacttcacatcaaacttgtgcctgga
aaattgactatcgatgagtctaatcctcaagattgcaatcataggcagtttgcgtactgt
tctttcccggatgtcagattaaacgttcacctagagagacttgtgcatcataatttaaag
gttgccgtggtagagcaagcagaaacaagcgctattaagaagcatgatccaggtgccagc
aaatcaagcgtttttgaaagaaagatttcaaatgtctttaccaaagctacatttggtgtt
aattccacctttgtccttagggggaaacgtattctcggtgatacaaacagtatatgggct
ttgtcccgtgacgtacatcagggaaaggtggctaaatattccttaatttctgtcaattta
aataacggggaagtcgtgtatgatgaatttgaagagcctaatcttgctgatgagaaacta
cagatacgaatcaaatatttacagcccatagaagtactggtaaatacagatgatcttcca
ttacatgtagcgaaatttttcaaagatatttcatgtcctttaatacacaagcaggagtat
gatttggaagatcatgtagttcaggcaataaaagtaatgaatgagaaaattcaactctcg
ccgtctctcatacgcttagtttctaagttatattcgcatatggttgagtacaataatgag
caggtgatgttgattccttctatctattcgcccttcgcatcaaaaatacatatgttactt
gatcctaactccctgcaaagtttggacatttttacccatgatggtggtaaaggttctttg
ttttggttattggaccatacaaggacatcgtttggattaagaatgttgagagaatggatt
ctcaaacctttggttgatgtacaccaaattgaagagcggcttgatgccattgagtgcatt
acatccgaaatcaacaacagtatattttttgaatcgttgaatcaaatgttgaatcatacc
cctgacttattaagaactttaaatcgcataatgtatggtacaacttctagaaaagaagtc
tatttctatttaaagcaaataacttctttcgttgatcacttcaagatgcatcaatcttac
ctgtcagaacatttcaagtcatcagatggaaggataggcaaacaatctcctttacttttt
agactatttagtgaattgaatgaactactttctaccactcagttgcctcattttttgacc
atgatcaacgtttctgcggtaatggaaaaaaattcagataagcaagtaatggattttttt
aatttaaataactatgattgttcagagggtataataaaaattcaaagggaaagcgaatca
gtacggtcacagttaaaggaagaattggcagaaatacgaaaatatctcaaacgtccatat
ctaaattttagagatgaagttgattacttaatcgaagtgaaaaactcgcaaattaaggac
ttgccagatgattggataaaagttaacaatacgaagatggtcagtagatttaccactccc
agaacccagaaactgactcaaaagctagaatattacaaggacttattaattcgggaatct
gaactacagtataaagaattcttgaacaaaattacggcagaatatacagagctccgtaaa
attacactcaatttggcgcagtatgactgtattttgtcgttagcagccacatcatgcaac
gtaaattatgttagaccaacttttgtgaatggtcaacaagccataatcgcaaaaaatgca
agaaatccaattatcgagtcgctggatgttcattatgtaccaaatgatatcatgatgtcc
ccagaaaacggtaaaatcaatattataacggggccgaatatgggtgggaaatcatcttat
attagacaagtggcactgcttactataatggcacagatcggctcatttgtccccgcagaa
gagatcagattaagcatatttgaaaacgtactcactcgaatcggtgcgcacgatgatatt
ataaacggtgattctacttttaaagtggaaatgcttgatatcctacacatcttgaaaaat
tgcaataaacggtctttactattattagacgaagtgggaagaggtactggcacgcacgat
ggtatagcaatttcttatgctttaataaagtatttttctgagttaagtgactgccccttg
atattatttactacccattttcccatgctgggagaaatcaaatctccgttaataaggaat
tatcatatggattacgtggaagaacaaaaaactggcgaggactggatgagtgtaattttt
ctatataagttaaaaaagggattgacttataatagttatgggatgaatgtggcgaaattg
gcacgcctggacaaagatattataaatcgggcattcagtatttcagaagaattgcggaag
gaatccattaacgaagacgcgttgaaattattcagctctttgaaaagaatattaaaaagt
gataatataacagcaacggataaactcgcgaaattactatcattggatatccactga

DBGET integrated database retrieval system